KEGG   Mycolicibacter terrae: 4434518_01295Help
Entry
4434518_01295     CDS       T05465                                 

Gene name
scoB_1
Definition
(GenBank) succinyl-CoA:3-ketoacid-coenzyme A transferase subunit beta ScoB
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
mter  Mycolicibacter terrae
Pathway
mter00072  Synthesis and degradation of ketone bodies
mter00280  Valine, leucine and isoleucine degradation
mter00650  Butanoate metabolism
mter01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mter00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    4434518_01295 (scoB_1)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    4434518_01295 (scoB_1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4434518_01295 (scoB_1)
Enzymes [BR:mter01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     4434518_01295 (scoB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C ClpB_D2-small
Motif
Other DBs
NCBI-ProteinID: SNV64974
UniProt: A0A1X2E315
Position
1:1378049..1378690
Genome map
AA seq 213 aa AA seqDB search
MTLTRDQLAARVAAELEDGQYVNLGIGLPTLIPNHIPDGVSVVLHSENGILGVGPYPRRE
DIDADLINAGKETVTVLAGASFFSSSTSFGVIRGGHLDVAVLGAMQVSAVGDLANWMIPG
KMIKGMGGAMDLVHGARRVLVMMEHAAKDGSAKIVEHCTLPLTGARCVDRIITDLAVIDV
TDAGLQLVETAPGVSVDEVVAKTDAPMDLSKLS
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgacactcaccagggaccaactggcagcacgggtggccgccgaattggaggacgggcag
tacgtcaatctcggcatcgggctgcccaccctgattcccaaccacatccccgacggcgtc
agcgtcgtgctgcattcggagaacgggatcctcggtgtcgggccgtacccgcgccgcgag
gacatcgacgccgacctgatcaacgccggcaaagaaacagtgaccgtccttgcgggcgcg
tccttcttctcgtcgtccacctcgttcggggtgatccgcggcggccacctcgatgtggcg
gtgcttggcgccatgcaggtttcagcggtcggcgacctggccaactggatgatccccggc
aagatgatcaagggcatgggcggggcgatggatctggtgcacggggcgcgccgcgtcctc
gtgatgatggagcacgcggccaaagacggcagcgcgaagatcgtcgagcactgcacgctg
ccgctcaccggcgcccgctgcgtcgaccgcatcatcaccgacctggccgtcatcgacgtc
accgacgcgggcctgcagttggtcgagaccgcgccgggcgtctccgtcgatgaggtcgtc
gcgaaaaccgatgcgccgatggacctgtcgaaactgtcatga

DBGET integrated database retrieval system