KEGG   Mycolicibacter terrae: 4434518_02456Help
Entry
4434518_02456     CDS       T05465                                 

Gene name
dfrA
Definition
(GenBank) dihydrofolate reductase DfrA
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
mter  Mycolicibacter terrae
Pathway
mter00670  One carbon pool by folate
mter00790  Folate biosynthesis
mter01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mter00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    4434518_02456 (dfrA)
   00670 One carbon pool by folate
    4434518_02456 (dfrA)
Enzymes [BR:mter01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     4434518_02456 (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: SNV77851
UniProt: A0A1X2E166
Position
1:complement(2634334..2634816)
Genome map
AA seq 160 aa AA seqDB search
MSSPALIWAQSVSGVIGRAGGIPWRLPEDQARFKELTLGHRVVMGRLTWESLPAAVRPLP
GRTNVVVTRRPDYSADGAEVVPTLEAALTDAETWVIGGAQIYALALPLATRCEVTEVEID
LPRQDADAVAPVLDESWQGTTGPWLTSEGGLRYRFHSYRR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgcccgcgttgatctgggcgcagtcggtgtcgggagtcatcgggcgggccggc
ggcatcccgtggcggctgccggaagaccaggcgcgcttcaaggagctcaccctggggcat
cgggtggtgatgggccggctcacctgggaatcactgccagccgccgtgcggccactgccg
ggacgcaccaatgtggtggtgacccgccgcccggactacagcgccgacggcgccgaagtg
gtaccgacgttggaggcggcgctgaccgatgccgagacctgggtgatcggcggcgcgcag
atctacgcactggcgctgccgctggccacccgatgtgaggtgaccgaggtcgagatcgac
ctgccccgccaagacgcggacgccgtcgcgccggtgctcgacgagtcctggcagggcacc
accgggccctggctgaccagcgagggcggcctgcggtaccggttccacagctaccgtcgc
tga

DBGET integrated database retrieval system