KEGG   Mycolicibacter terrae: 4434518_02591Help
Entry
4434518_02591     CDS       T05465                                 

Gene name
nylA
Definition
(GenBank) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
mter  Mycolicibacter terrae
Pathway
mter00330  Arginine and proline metabolism
mter00360  Phenylalanine metabolism
mter00380  Tryptophan metabolism
mter00627  Aminobenzoate degradation
mter00643  Styrene degradation
mter01100  Metabolic pathways
mter01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mter00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    4434518_02591 (nylA)
   00360 Phenylalanine metabolism
    4434518_02591 (nylA)
   00380 Tryptophan metabolism
    4434518_02591 (nylA)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    4434518_02591 (nylA)
   00643 Styrene degradation
    4434518_02591 (nylA)
Enzymes [BR:mter01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     4434518_02591 (nylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: SNV81209
UniProt: A0A240AD36
Position
1:complement(2768604..2770067)
Genome map
AA seq 487 aa AA seqDB search
MVVEPEAMSDLAQQTRWLDATAQAELVAKGEVSPSELLEAAIERIEQSNPALNAVVIEWF
DHARSVAAGRGLPAGPFRGVPFLLKDLYTSFAGQTLSNGNVALKNAALRDVSDSTLVARF
KAAGLVVAGRTNSPEFGSLPTTQPLAWGATRNPWALERTPGGSSGGAGAAVAAGMVPFAN
ASDGGGSIRIPASCCGLVGLKPSQGRITVGPDRAEVGLGVELGVSRTVRDTAGLLDAVRG
PGVGDTVIAPAPRRPYIEEVFADPGRLRVGLLDEHPRGEFLHEDCRTAVRATASLLEGLG
HTVEQAWPACLADTTLTEKFMALWATQMGMAARQIGAALRRQVTADDMEPVNWALVEQAR
RLTAVDYAAAQAAGWAFRRALQQWWADGWDLLLTPTLAEPPLALSEFENDPADPTAPMRR
AGRFAVFTPPFNMSGQPAISLPLHRSAEGLPIGVQLVADYGREDVLIQVAAQLEAAHPWA
SVHPPQY
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
gtggtggtagaaccggaagccatgagtgacctcgcccagcagaccaggtggctggatgcc
accgcgcaggcggagctggtcgccaagggtgaggtcagcccgagcgagctgctggaagcg
gcgatcgagcggatcgaacagtcgaatccggccctgaacgccgtggtcatcgagtggttc
gaccatgctcgatcggtggccgccggtcgggggctgcccgccggcccgtttcggggcgtc
ccgttcctgctcaaggatctctacaccagtttcgccggccaaaccctgtccaacggcaac
gtggcgctgaagaacgccgccctgcgggacgtctcggactcgacgctggtcgctcgattc
aaagcggccgggttggtcgtcgcggggcgcaccaacagtccggagttcggcagcctgccg
accacgcagccgctggcctggggggcgacccgcaacccatgggcgctggaacggacaccg
ggcgggtccagtggcggtgcgggtgccgccgtggccgccgggatggtgccgttcgccaac
gcctccgacggtgggggcagcatccgtatcccggcgtcgtgctgcgggctggtgggactc
aagcccagccagggcaggatcaccgtcggtccggaccgcgccgaggtggggttgggtgtc
gaactgggcgtcagccgtacagtgcgtgacaccgcggggctactcgatgcggtgcgcggc
cccggtgtcggcgacaccgtgatcgcgccggccccgcggcgcccgtacatcgaggaggtc
tttgccgaccccgggaggttgcgggtcgggttgctcgacgagcacccgcgcggcgagttt
ttgcacgaagactgccgaacggcggtgcgcgcgacggcatcgctgttggaagggctcggc
cacaccgtcgaacaggcgtggccggcttgcctggccgacaccacgctgaccgagaaattc
atggcactgtgggcgacgcagatggggatggctgcccgccagatcggcgcggcactgcgc
cgccaggtgacggcggacgacatggagccggtgaactgggcgctggtcgagcaggcgcgg
cggctgaccgccgtcgactacgccgcagcccaggcggcgggctgggccttccggcgcgca
ctgcagcaatggtgggccgacggttgggatctcctgctcacgcccacgctggccgagccg
ccgcttgccctcagtgagttcgagaacgacccggcggacccgacggcgccgatgcgccgg
gccgggcggttcgccgtgttcacgccgccgttcaacatgagcggacagccggcgatcagc
cttccgctgcaccgcagtgccgagggtctgccgatcggcgtccagctcgtcgccgactac
ggccgggaggatgtcctgatccaggtggccgctcaactggaagccgcgcacccgtgggcg
tcggtgcatccgcctcagtactga

DBGET integrated database retrieval system