KEGG   Mycolicibacter terrae: 4434518_03163Help
Entry
4434518_03163     CDS       T05465                                 

Gene name
cobQ
Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
mter  Mycolicibacter terrae
Pathway
mter00860  Porphyrin and chlorophyll metabolism
mter01100  Metabolic pathways
Module
mter_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:mter00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    4434518_03163 (cobQ)
Enzymes [BR:mter01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     4434518_03163 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 GATase MobB DJ-1_PfpI Peptidase_S51 Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: SNV88571
UniProt: A0A1X2E5A4
Position
1:complement(3344622..3346073)
Genome map
AA seq 483 aa AA seqDB search
MTGLLIAGTTSDAGKTVVTTGLCRALARRGIKVAPYKAQNMSNNSMVVVGADGVGTEIGR
AQWIQALAARAVPEPAMNPVLLKPGSDQRSHVMLMGRPWGELSSSNWMDGRAELARAAHD
AFDDLAARYDVVIAEGAGSPTEINLRAGDYVNMGLARHAGLPTLVVGDVDRGGVFAAFFG
TVALLCPQDQALMAGFIVNKFRGQQQLLAPGLADLERLTGRPVVGTVPWHPGLWLDSEDA
LDLDGRRSVRTGARRVAVIRLPRISNFTDLDALGVEPDLDVVFASDPRGVSDADLVVLPG
TRATVSDLAWLRSRGLDSAIAEHAAAGKPVLGICGGFQMLGRAIRDPDGVEGPPGEVAGL
GLLDVETCFGTDKVLRLSAGGYEIHHGRITRGGGVKEFPGGARAGQVFGTMRHGSLEGDA
PRAAFLAETLGLEPSGVSFPAAREHRLDLLADLIEEHLDVDAVLDLARGGPPPGLPFLPP
GAP
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgacggggctgctgatcgccggaaccaccagcgacgccggcaagaccgtggtcaccacc
gggctgtgccgggcgctggcacgccgcgggataaaagtggctccctacaaggcgcagaac
atgtcgaacaactcgatggtggttgtcggtgcggatggcgtcggtaccgaaatcggccgg
gcgcaatggattcaggcgctggccgcgcgagccgtccccgagccggcgatgaacccggta
ctactcaaacccggcagtgaccagcgcagtcatgtgatgctgatgggccggccctggggt
gagctgtcgtcgtcgaattggatggacggccgggccgagttggcccgggccgcgcatgac
gccttcgacgacctcgcggcacgctacgacgtggtcatcgccgagggggccggcagcccg
accgaaatcaacctgcgtgccggcgattacgtcaacatgggtttggcccggcatgctggc
ctgccgacgctcgtcgtcggggacgtggatcgcggtggggtgttcgcggcgttcttcggc
acggtcgcgttgttgtgcccgcaagaccaggccctgatggccgggttcatcgtcaacaaa
ttccgcggccagcaacagttattggcgcccggtctggccgacctggagcggctcaccggc
cggccggtggtcggcaccgtgccgtggcatccggggctgtggctggactccgaggacgcg
ctcgatctggatggcaggcgctcagtgcgcaccggcgcacgacgggtggcggtgatccgg
ctgccgcggatcagcaacttcaccgatctggatgcgctcggtgtggaacccgatctggac
gtggtgttcgcctccgacccgcgtggggtgtccgacgccgacctggtggtgctgccggga
acccgcgccaccgtgtccgatctggcctggctgcggtcgcgggggctggattccgcgatc
gctgagcacgccgccgcgggcaaaccggtgctggggatctgcgggggctttcagatgctg
ggccgggcgatccgcgaccccgacggcgtggagggaccgccgggcgaggtggccgggttg
ggcctactggacgtcgaaacctgtttcggcacagacaaagtgctgcgcctctccgcgggc
ggctacgagatacatcacggtcggatcacccgcggtggcggcgtgaaggaatttcccggc
ggcgcccgcgccggtcaggtcttcggcaccatgcggcacggcagtctcgagggcgatgcc
ccccgcgcggctttcctggccgaaaccctgggcctggaaccatcgggagtatcgtttccc
gccgctcgggagcaccggctcgacttgctggccgatctgatcgaggagcacctggacgtc
gacgccgtcctggacttggcgcgcggcggaccgccgccgggtctgccgttcctgccgccg
ggggcaccgtga

DBGET integrated database retrieval system