KEGG   Mycolicibacter terrae: 4434518_03174Help
Entry
4434518_03174     CDS       T05465                                 

Gene name
icd2
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mter  Mycolicibacter terrae
Pathway
mter00020  Citrate cycle (TCA cycle)
mter00480  Glutathione metabolism
mter01100  Metabolic pathways
mter01110  Biosynthesis of secondary metabolites
mter01120  Microbial metabolism in diverse environments
mter01130  Biosynthesis of antibiotics
mter01200  Carbon metabolism
mter01210  2-Oxocarboxylic acid metabolism
mter01230  Biosynthesis of amino acids
Module
mter_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mter_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mter00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4434518_03174 (icd2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4434518_03174 (icd2)
Enzymes [BR:mter01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     4434518_03174 (icd2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: SNV88632
UniProt: A0A1X2DY79
Position
1:complement(3359141..3361375)
Genome map
AA seq 744 aa AA seqDB search
MCADQPTIIYTLTDEAPLLATYSFLPIVQAFTGPADIDVKPSDISLGARILAEFPDFLTE
EQRVPNNLAELGRLTQLPDTTIIKLPNISASVPQLVAAIKELQGKGFNLPDYPEDPKTDD
ERDIHDRYAKCLGSAVNPVLREGNSDRRAPKAVKEYARKHPHSMGEWSQASRTHVATMRH
GDFYHGEKSMTLDRDRDVKMELKTESGKTIVLKEKVSLLDGMVIDSMFMSVRALREFYEE
QMEDAHKTGVMFSLHVKATMMKVSHPIVFGHAIKVFYKDAFAKHQKLFDDLGVNVNNGLS
DLYNKIEALPASQREEVIEDLHACHEHRPKLAMVDSANGISNFHSPSDVIVDASMPAMIR
AGGKMYGADGRPRDTKAVNPESTFARIYQEMINFCKTHGQFDPATMGTVPNVGLMAQQAE
EYGSHDKTFEVPESGVADIVDLATGEVLLTQNVEAGDIWRLCTVTDAAIRDWVKLAVQRA
RASGMTAVFWLDTERPHEAELRKKVKAYLLDHDTEGLEIQIMPQVWAMRYTLERLIRGQD
TIAVTGNILRDYLTDLFPILELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVKQLVEEN
HLRWDSLGEFLALAASFDDLGAKTGNPNAKILGSTLDAAIGKLLDANKSPSRKTGELDNR
GSQFFLAKYWAEELAAQTEVPELAKQFVAVAEALEKNQDAILTELTVVQGEPVDIGGYYA
PDHDMTAAVMRPSSTLNAVIDAKG
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgccgaccagccgaccatcatctacacgctgaccgacgaggcgccgctattggcg
acgtattcgttcctgccgatcgtgcaggctttcaccgggcccgcggatatcgacgtcaag
cccagcgacatctcgctgggggcgcgcatcctggccgagttccccgacttcctgaccgag
gagcagcgggtgccgaacaacctggccgaactcggccggctcacccagctgcccgacacc
acgatcatcaaactgcccaatatcagcgcctcggtgccgcaactggtcgccgccatcaag
gaactgcagggcaagggcttcaacctgccggactatcccgaggacccgaagaccgacgac
gagcgcgacattcacgaccgctacgccaagtgcctgggcagcgcggtgaatcctgttctg
cgggagggtaactcggaccggcgtgcgcccaaggcggtcaaggaatacgcgcgcaagcac
ccgcacagcatgggcgagtggtcgcaggcgtcgcgcacgcatgtggccaccatgcgccac
ggtgacttctaccacggcgagaagtcgatgacgctggaccgcgaccgcgacgtgaagatg
gaactgaagaccgagagcggcaagacgatcgtgctcaaggagaaggtgtcgctgctcgac
ggcatggtcatcgactcgatgttcatgagtgtgcgtgcgctgcgtgagttctacgaagag
cagatggaggacgcccacaagaccggcgtgatgttctcgctgcacgtcaaggccaccatg
atgaaggtcagccaccccatcgtgttcggccacgccatcaaggtcttctacaaggacgcg
ttcgccaagcaccagaagctcttcgacgacctgggtgtcaacgtcaacaacgggctgtcc
gacctgtacaacaagatcgaggcgctgccggcctcgcagcgcgaggaggtcatcgaggac
ctgcacgcctgccacgagcaccgtcccaagctggcgatggtcgactcggccaacggcatc
tcgaacttccactcgccctcggatgtgatcgtggacgcctcgatgcccgcgatgatcagg
gccggcggcaagatgtacggcgccgatggccggccgcgcgacaccaaggccgtcaacccg
gagtcgacgttcgcccggatctaccaggagatgatcaacttctgcaagactcacggccag
ttcgacccggccaccatgggcaccgtccccaacgtcgggttgatggcccagcaggccgag
gagtacggcagccacgacaagacgttcgaggtgcccgagagcggtgtcgccgacatcgtg
gatctggccaccggtgaggtgttgctgacccagaacgtggaggccggcgatatctggcgg
ttgtgcaccgtcaccgacgccgccatccgggactgggtgaagctggccgtgcagcgggcg
cgggcctcgggcatgacggcggtgttctggctggacaccgagcgtccgcatgaggccgaa
ctgcgcaagaaggtcaaggcctacctgttggaccacgacaccgagggcctggaaatccag
atcatgccgcaggtgtgggccatgcgctacaccctggagcggctgatccgcggccaggac
accatcgcggtgaccggcaacatcctgcgcgactacctgaccgacctgttcccgatcctg
gagctgggcaccagcgccaagatgctgtcgatcgtgccgctgatggccggcggcggaatg
tacgagacgggcgcgggaggttcggcgcccaagcacgtcaagcagctggtggaggagaac
cacctgcgctgggactcgctgggcgaattcctcgcgctggccgccagtttcgacgacctg
ggggccaagacgggcaacccgaacgccaagatcctgggctcgaccctcgacgcggcgatc
ggcaagctgctcgacgccaacaagagcccgtcacgcaagaccggtgagctggacaaccgc
ggcagccagttcttcctcgccaagtactgggcggaggaactcgccgcgcagaccgaggtc
cccgagctggccaagcagttcgtcgcggtggctgaggcgctggagaagaaccaggacgcc
attcttaccgaactgaccgtggtgcagggcgagccggtggacatcggcggctactacgcg
ccggatcacgacatgacggcggcggtgatgcggcccagctcgacgctgaacgctgtgatc
gacgccaagggctga

DBGET integrated database retrieval system