KEGG   Mycobacterium tuberculosis F11: TBFG_11144Help
Entry
TBFG_11144        CDS       T00545                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase zwf1
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
mtf  Mycobacterium tuberculosis F11
Pathway
mtf00030  Pentose phosphate pathway
mtf00480  Glutathione metabolism
mtf01100  Metabolic pathways
mtf01110  Biosynthesis of secondary metabolites
mtf01120  Microbial metabolism in diverse environments
mtf01130  Biosynthesis of antibiotics
mtf01200  Carbon metabolism
Module
mtf_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mtf_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:mtf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TBFG_11144
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    TBFG_11144
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtf04147]
    TBFG_11144
Enzymes [BR:mtf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     TBFG_11144
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     TBFG_11144
Exosome [BR:mtf04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   TBFG_11144
  Exosomal proteins of colorectal cancer cells
   TBFG_11144
  Exosomal proteins of bladder cancer cells
   TBFG_11144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ABR05487
Position
1247474..1248874
Genome map
AA seq 466 aa AA seqDB search
MVDGGGGASDLLVIFGITGDLARKMTFRALYRLERHQLLDCPILGVASDDMSVGQLVKWA
RESIGRTEKIDDAVFDRLAGRLSYLHGDVTDSQLYDSLAELIGSACRPLYYLEMPPALFA
PIVENLANVRLLERARVAVEKPFGHDLASALELNARLRAVLGEDQILRVDHFLGKQPVVE
LEYLRFANQALAELWDRNSISEIHITMAEDFGVEDRGKFYDAVGALRDVVQNHLLQVLAL
VTMEPPVGSSADDLNDKKAEVFRAMAPLDPDRCVRGQYLGYTEVAGVASDSATETYVALR
TEIDNWRWAGVPIFVRAGKELPAKVTEVRLFLRRVPALAFLPNRRPAEPNQIVLRIDPDP
GMRLQISAHTDDSWRDIHLDSSFAVDLGEPIRPYERLLYAGLVGDHQLFAREDSIEQTWR
IVQPLLDNPGEIHRYDRGSWGPEAAQSLLRGHRGWQSPWLPRGTDA
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
ttggttgacggcggaggtggcgcgtcagatctgttggtgatcttcggaattaccggtgac
ctggcccgcaagatgaccttccgcgcgttgtatcggctcgagcgccaccagttgctggac
tgccccatcctgggtgtggccagtgacgacatgtccgtcgggcagttggtcaagtgggct
cgcgagtccatcggtcgtaccgaaaagatcgacgatgcggtgttcgaccggttggcgggc
cggttgtcctacctgcacggtgacgtcaccgacagccagctctacgattcgctggccgaa
ctgattggctcggcctgtcggccgctgtattacctggaaatgccgccggcgctgttcgcg
ccgattgtcgaaaatctcgcgaacgtgcggctgttggagcgcgcacgcgttgccgtggaa
aagccgttcggccacgacctggcctccgcgctcgaactcaacgcccggctgcgagcggtg
ttgggcgaagaccaaatcctgcgtgtggaccactttctgggcaagcagcccgtcgtcgag
ctggagtacctgaggttcgccaatcaggcgttagccgagctctgggatcgcaacagcatc
tccgagatccacatcaccatggccgaggacttcggggtggaggaccgcggcaagttttac
gacgccgtcggtgccctgcgtgacgtcgtgcaaaaccatctgctgcaggtgctggcgctg
gtgacgatggaaccgccggtcggttccagcgccgatgacctcaacgacaagaaggccgag
gtcttccgggcgatggcgccgctggatcccgatcggtgcgtgcgtgggcagtacctcggc
tacaccgaagttgcgggcgtagcaagcgattcggcgaccgaaacgtatgtcgcgctgcga
accgagatcgacaactggcgctgggccggggtgccgatcttcgtgcgggccggaaaagag
ctgcccgcgaaggtcaccgaagtacggctatttctacgccgagttccggcattggccttt
ctgcccaaccgccgaccggccgagcccaaccagattgtgctgcgtatcgaccccgatccg
ggtatgcgactgcagatttcggcccacaccgacgactcgtggcgagatatccacctggac
tcctcgttcgcggtggacctcggtgaaccgatacgaccctatgagcggctgctgtatgcc
ggattggtcggcgatcaccagttgttcgcccgcgaggacagcatcgagcagacgtggcgg
atcgtgcagccgctgctcgacaacccgggtgaaatccatcggtacgatcgcggttcctgg
ggtccggaagccgcgcagtcgttgctgcgcggtcaccgcggttggcagtcgccgtggctg
ccccgcggcacggacgcatga

DBGET integrated database retrieval system