KEGG   Mycobacterium tuberculosis F11: TBFG_12185Help
Entry
TBFG_12185        CDS       T00545                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine-D-glutamate ligase murD
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
mtf  Mycobacterium tuberculosis F11
Pathway
mtf00471  D-Glutamine and D-glutamate metabolism
mtf00550  Peptidoglycan biosynthesis
mtf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    TBFG_12185
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TBFG_12185
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mtf01011]
    TBFG_12185
Enzymes [BR:mtf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     TBFG_12185
Peptidoglycan biosynthesis and degradation proteins [BR:mtf01011]
 Precursor biosynthesis
  Amino acid ligase
   TBFG_12185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: ABR06516
Position
complement(2428495..2429955)
Genome map
AA seq 486 aa AA seqDB search
MLDPLGPGAPVLVAGGRVTGQAVAAVLTRFGATPTVCDDDPVMLRPHAERGLPTVSSSDA
VQQITGYALVVASPGFSPATPLLAAAAAAGVPIWGDVELAWRLDAAGCYGPPRSWLVVTG
TNGKTTTTSMLHAMLIAGGRRAVLCGNIGSAVLDVLDEPAELLAVELSSFQLHWAPSLRP
EAGAVLNIAEDHLDWHATMAEYTAAKARVLTGGVAVAGLDDSRAAALLDGSPAQVRVGFR
LGEPAAGELGVRDAHLVDRAFSDDLTLLPVASIPVPGPVGVLDALAAAALARSVGVPAGA
IADAVTSFRVGRHRAEVVAVADGITYVDDSKATNPHAARASVLAYPRVVWIAGGLLKGAS
LHAEVAAMASRLVGAVLIGRDRAAVAEALSRHAPDVPVVQVVAGEDTGMPATVEVPVACV
LDVAKDDKAGETVGAAVMTAAVAAARRMAQPGDTVLLAPAGASFDQFTGYADRGEAFATA
VRAVIR
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
gtgcttgaccctctggggccgggtgcgcccgtgttggtagccggtggccgggtgaccggt
caggcggtggccgcggtgctgactcggtttggtgcgacgccgacggtgtgcgacgacgat
ccggtcatgctgcgaccgcacgccgaacgtgggctgccgaccgttagttcctcggacgcg
gtgcagcagataaccgggtatgcgctggtggtcgccagtcccggcttctcgcccgcaacc
ccgctactggccgcggccgcggcggcgggggtgccgatctggggtgacgtggagttagcc
tggcggctagacgcagcgggctgctacggaccgccgcgcagctggctggtggtgaccggc
accaacggcaagaccaccacgacgtcgatgctgcacgccatgctgatcgccggtggccgc
cgcgccgtgctgtgcggcaatatcggcagtgcggtgctggatgtgctggacgagccggcc
gagctgctggccgtggagttgtccagtttccagctgcactgggcgccgtcgctgcggccc
gaggccggcgcggtgctcaacattgccgaagaccacctggactggcatgccacgatggcc
gaatacaccgcggccaaggcccgggtgctgaccggcggggtagcggtggccgggctggat
gacagccgagcggccgcactgctggacggctcaccggcgcaggtgcgggtcggcttccgg
ctcggcgagccggccgcgggggaactgggcgtgcgcgacgcccacctggtcgatcgcgcc
ttctccgacgacttgacgctgctgccggtcgcgtcgataccggtgccaggtccggtcggc
gtgcttgacgccctggccgcggcggcgctggcccgctcggtcggggtgcccgccggtgcg
atcgccgacgcggtcacgtcgtttcgagtgggccgacaccgcgccgaggtggtggccgtt
gccgacggcatcacctacgtggacgactccaaggccaccaacccgcacgccgcgcgggct
tcggtgcttgcatacccgagggtggtatggatcgccggtggcctgctcaagggcgcgtcg
cttcacgccgaggttgcggcgatggcgtcgcggctggtcggtgcggtgctgatcggccgg
gatcgcgcagcggttgccgaggcgttatcacgacacgcgcccgatgtcccagtcgttcag
gttgtggcaggcgaggatactggtatgcctgcgactgttgaggttcctgttgcttgtgtt
ctagatgtggcaaaagatgacaaagccggtgagaccgttggcgctgccgtgatgaccgct
gcggtggccgcggcccggcggatggcccaacccggtgacaccgtgctgctggcaccggcc
ggcgcctcattcgaccagttcaccggttatgccgaccggggcgaggcattcgcgaccgcg
gtccgcgcggtgatccggtag

DBGET integrated database retrieval system