KEGG   Mycobacterium tuberculosis F11: TBFG_12373Help
Entry
TBFG_12373        CDS       T00545                                 

Definition
(GenBank) phospholipase C 3 plcC
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
mtf  Mycobacterium tuberculosis F11
Pathway
mtf00562  Inositol phosphate metabolism
mtf00564  Glycerophospholipid metabolism
mtf00565  Ether lipid metabolism
mtf01100  Metabolic pathways
mtf01110  Biosynthesis of secondary metabolites
mtf02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mtf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    TBFG_12373
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    TBFG_12373
   00565 Ether lipid metabolism
    TBFG_12373
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    TBFG_12373
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:mtf02042]
    TBFG_12373
Enzymes [BR:mtf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     TBFG_12373
Bacterial toxins [BR:mtf02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   TBFG_12373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase TAT_signal
Motif
Other DBs
NCBI-ProteinID: ABR06702
Position
complement(2637969..2639519)
Genome map
AA seq 516 aa AA seqDB search
MSQGAFAGMSRRAFLAKAAGAGAAAVLTDWAAPVIEKAYGAGPCSGHLTDIEHIVLCLQE
NRSFDHYFGTLSAVDGFDTPTPLFQQKGWNPETQALDPTGITLPYRINTTGGPNGVGECV
NDPDHQWIAAHLSWNGGANDGWLPAQARTRSVANTPVVMGYYARPDIPIHYLLADTFTIC
DQYFSSLLGGTMPNRLYWISATVNPDGDQGGPQIVEPAIQPKLTFTWRIMPQNLSDAGIS
WKVYNSKLLGGLNDTSLSRNGYVGSFKQAADPRSDLARYGIAPAYPWDFIRDVINNTLPQ
VSWVVPLTVESEHPSFPVAVGAVTIVNLIRVLLRNPAVWEKTALIIAYDEHGGFFDHVTP
LTAPEGTPGEWIPNSVDIDKVDGSGGIRGPIGLGFRVPCFVISPYSRGGLMVHDRFDHTS
QLQLIGKRFGVPVPNLTPWRASVTGDMTSAFNFAAPPDPSPPNLDHPVRQLPKVAKCVPN
VVLGFLNEGLPYRVPYPQTTPVQESGPARPIPSGIC
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
gtgagccaaggtgcattcgccggaatgtcacgccgagcattcctggctaaggcggctgga
gccggggcagcggcggttttgacggactgggccgcaccggtgatcgaaaaggcctatggt
gccggtccctgctcgggtcatttgaccgatatcgagcacatcgtgctgtgcctacaggag
aacaggtcgttcgatcactatttcggcacgctttctgccgtcgacgggttcgacactccg
acgccgctgtttcaacaaaagggctggaacccggagacgcaggcgctggaccccaccggc
attacgctgccctaccgcatcaataccaccgggggtcccaacggggttggcgagtgcgtc
aacgacccagaccaccagtggattgccgcgcacttgtcatggaacggcggcgccaatgac
ggctggctgccggcgcaggcgcggacccggtcggtggccaacacgcccgtggtgatgggc
tattacgcacgtcctgacataccgatccactacttgttggccgataccttcacgatctgc
gaccagtacttctcgtcgcttcttggcgggacgatgcctaaccggctctattggatcagc
gccaccgtcaatcccgacggggatcaaggtgggccgcagatcgtcgaacccgccatccag
ccgaagttgaccttcacctggcgcatcatgccgcagaacctcagtgacgccggcatcagt
tggaaggtgtacaacagcaagctgctcggcgggctcaacgacacttccttgagccgtaac
gggtatgtgggcagtttcaaacaggccgcagatccgaggtcggacctggcccgttatggc
atcgccccggcctacccgtgggatttcatccgcgacgtcatcaacaacacgctgccccag
gtgtcctgggtcgttccgttgaccgtcgagtccgaacatccgtcattcccggtggcagtc
ggtgcggtgacgatcgtgaacttgataagggtgttgctgcgcaatccggcggtgtgggag
aaaaccgcgttgatcatcgcctatgacgaacatggcggcttcttcgaccacgtcacaccg
ctcaccgcgccggagggcacacccggcgaatggattcccaacagtgttgacatcgacaag
gtcgacggctccggcggaatacgtggacccatcggcttgggctttcgcgtgccctgcttc
gtcatttcgccttacagtcgcggcgggctgatggtccatgatcggttcgaccacacatcg
cagctgcaattgatcggcaagcgtttcggggtgccggttcccaacttgacaccctggcgt
gccagtgtcaccggcgatatgacgtcggcattcaatttcgcggccccgccggacccgtcg
ccacccaatctggaccacccggtccgtcaattgccgaaggtcgccaagtgcgtgcccaat
gtggtgctgggtttcttgaacgaaggcctgccgtatcgggtgccctacccccaaacaacg
ccagtccaggaatccggtcccgcgcggccgattcccagcggcatctgctag

DBGET integrated database retrieval system