KEGG   Mycobacterium tuberculosis F11: TBFG_12982Help
Entry
TBFG_12982        CDS       T00545                                 

Definition
(GenBank) pyruvate carboxylase pca
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
mtf  Mycobacterium tuberculosis F11
Pathway
mtf00020  Citrate cycle (TCA cycle)
mtf00620  Pyruvate metabolism
mtf01100  Metabolic pathways
mtf01120  Microbial metabolism in diverse environments
mtf01200  Carbon metabolism
mtf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TBFG_12982
   00620 Pyruvate metabolism
    TBFG_12982
Enzymes [BR:mtf01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     TBFG_12982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl ATPgrasp_Ter Biotin_lipoyl_2 Dala_Dala_lig_C RnfC_N ATP-grasp GCV_H ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ABR07309
Position
complement(3331136..3334519)
Genome map
AA seq 1127 aa AA seqDB search
MFSKVLVANRGEIAIRAFRAAYELGVGTVAVYPYEDRNSQHRLKADESYQIGDIGHPVHA
YLSVDEIVATARRAGADAIYPGYGFLSENPDLAAACAAAGISFVGPSAEVLELAGNKSRA
IAAAREAGLPVLMSSAPSASVDELLSVAAGMPFPLFVKAVAGGGGRGMRRVGDIAALPEA
IEAASREAESAFGDPTVYLEQAVINPRHIEVQILADNLGDVIHLYERDCSVQRRHQKVIE
LAPAPHLDAELRYKMCVDAVAFARHIGYSCAGTVEFLLDERGEYVFIEMNPRVQVEHTVT
EEITDVDLVASQLRIAAGETLEQLGLRQEDIAPHGAALQCRITTEDPANGFRPDTGRISA
LRTAGGAGVRLDGSTNLGAEISPYFDSMLVKLTCRGRDLPTAVSRARRAIAEFRIRGVST
NIPFLQAVLDDPDFRAGRVTTSFIDERPQLLTARASADRGTKILNFLADVTVNNPYGSRP
STIYPDDKLPDLDLRAAPPAGSKQRLVKLGPEGFARWLRESAAVGVTDTTFRDAHQSLLA
TRVRTSGLSRVAPYLARTMPQLLSVECWGGATYDVALRFLKEDPWERLATLRAAMPNICL
QMLLRGRNTVGYTPYPEIVTSAFVQEATATGIDIFRIFDALNNIESMRPAIDAVRETGSA
IAEVAMCYTGDLTDPGEQLYTLDYYLKLAEQIVDAGAHVLAIKDMAGLLRPPAAQRLVSA
LRSRFDLPVHLHTHDTPGGQLASYVAAWHAGADAVDGAAAPLAGTTSQPALSSIVAAAAH
TEYDTGLSLSAVCALEPYWEALRKVYAPFESGLPGPTGRVYHHEIPGGQLSNLRQQAIAL
GLGDRFEEIEEAYAGADRVLGRLVKVTPTSKVVGDLALALVGAGVSADEFASDPARFGIP
ESVLGFLRGELGDPPGGWPEPLRTAALAGRGAARPTAQLAADDEIALSSVGAKRQATLNR
LLFPSPTKEFNEHREAYGDTSQLSANQFFYGLRQGEEHRVKLERGVELLIGLEAISEPDE
RGMRTVMCILNGQLRPVLVRDRSIASAVPAAEKADRGNPGHIAAPFAGVVTVGVCVGERV
GAGQTIATIEAMKMEAPITAPVAGTVERVAVSDTAQVEGGDLLVVVS
NT seq 3384 nt NT seq  +upstreamnt  +downstreamnt
gtgttttccaaggtgctcgtcgccaatcgcggggagatcgcgatccgggcctttcgtgcc
gcctacgaactgggcgtcggaaccgtggccgtttatccgtacgaggaccgcaattcgcag
caccgtctcaaggcggacgagtcttaccagatcggcgacatcggtcacccggtgcatgca
tacctgtcggtcgacgagatcgtcgcgacggcccgtcgggcgggtgccgacgctatctac
cctggctacgggtttctatcggagaatccggatctggctgcggcatgcgcggcggcgggc
atcagcttcgtcggtcccagcgccgaagtgcttgagctggctgggaataagtctcgcgcc
atcgcggcggcccgcgaagccggcttgcccgtgctgatgtcctcggcgccgtcggcctcg
gtcgacgaactgctgtcggttgcggccggcatgccgtttccgttgttcgtcaaggcagtt
gccggtggcgggggccggggtatgcgtcgtgtcggcgatatcgcggcgcttccggaggcg
atcgaagccgccagccgggaagccgagtcggcgttcggggacccgacggtctatctcgag
caggcagtgatcaatccacgccacatcgaggtgcagattctggcggacaacctcggcgac
gtgatccatctctatgagcgtgactgcagtgtgcagcgtcgccatcagaaggtcatcgag
ctggcgcccgcgccgcacctggacgccgagttgcgttacaagatgtgcgtcgatgcggtc
gccttcgcccgccatatcgggtacagctgcgcgggcaccgtcgagttcctgctggacgag
cgaggggagtatgtcttcatcgagatgaatccgcgggttcaggtggagcacacggtgacc
gaggagattaccgacgtcgacctggtcgccagccagctgcgcattgccgccggggagacg
ctcgaacaattgggcctgcggcaggaggacatcgcaccgcatggcgccgcactacagtgc
cggatcaccaccgaggatccggccaacggcttccggccggacacgggccggatcagcgcg
ttgcgcaccgccggcggtgccggtgtccgcctggacggcagcaccaacctgggcgcagaa
atcagcccgtacttcgactccatgctggtcaagctgacctgtcggggccgtgacctccct
accgcagtgagccgtgcgcgccgggcgatcgcggagttccggatccgcggggtatcgacg
aatattccgttcctgcaagcggtcctggatgacccggacttccgagcgggccgggtcacc
acgtccttcattgatgagcggccgcagctgctgaccgcgcgcgcctcggccgaccgcggc
accaagatccttaacttcctggccgatgtcaccgtcaacaacccgtatggctcgcgtccg
tcaacgatctacccggacgacaagctgcccgatcttgatctgcgggccgcaccaccggcc
gggtccaagcagcgactagtcaagttggggccggaaggatttgctcgttggctgcgggag
tcggccgcggtcggggtcaccgataccacattccgggatgctcaccagtcgttactggct
acccgagtacgcaccagcggactgtcgcgggtggcaccgtatctcgcgcggaccatgccg
cagctgttgtccgtggagtgttggggcggtgcgacttacgatgtggcgctgcgctttctc
aaggaggatccctgggaacggctggccacactgcgtgcagcaatgcccaatatctgcttg
cagatgctattgcggggccgcaataccgtgggctacacgccgtacccggaaatcgtgacg
tcggcgtttgtgcaagaagcaacagccaccggtatcgacatctttcgtatcttcgacgcg
ctcaacaacatcgagtcgatgcgtccggcgatcgacgcagtacgcgaaacaggttctgcg
atagcagaagtcgcgatgtgctacacgggcgaccttaccgatccgggtgaacagctgtac
acgctggactactacctgaaactggctgagcagatcgtggacgccggcgcccatgtgctg
gcgatcaaggatatggctggactgttgcgcccgccggccgctcaaaggttggtcagcgcc
ctgcgcagtcgcttcgacctgcccgttcacctgcacacccacgacacaccgggtggccag
ctcgccagctatgtggccgcttggcacgccggggccgatgccgtcgacggcgccgccgcg
ccgctggcgggaacgaccagccagcccgcgctgagctcgatcgttgctgccgctgcccac
accgagtacgacaccggcctgtcgctttcggcggtgtgcgccctggagccgtactgggag
gcgttacgaaaagtgtatgcgccgttcgagtctgggttgccggggccgacggggcgggtt
tatcaccacgagattccgggcggccaactgtccaatctgcgccagcaagcaattgctctt
ggtctgggagatcgattcgaagagatcgaagaggcctacgcgggcgccgaccgagtgttg
ggcaggctggttaaggtcacgccaacgtccaaggtggtcggcgatctggcgctggcactg
gtcggcgccggtgtcagtgcagacgaattcgcctccgatccagcgcgatttggcatcccg
gaatcggtactcggatttctgcggggcgagctgggtgatccgcccggcgggtggcccgaa
ccgctgcgcactgcggcgctggccggtcgcggggcggccaggcccactgcgcaattggcg
gcggacgacgagattgccctatcgtcggtcggagccaagcgtcaggccaccctgaacagg
ctgttatttcccagtccaacaaaggaattcaatgagcaccgggaagcctacggcgacacg
tcgcaattgtcggccaaccagttcttctatggtctgcgccaaggtgaagagcatcgggtg
aagctggagcgtggggtggagctgttgatcgggctggaggccatttccgaacccgacgaa
cgcggcatgcgaacggtgatgtgcatcctcaacgggcagctgcggccggtgctagtgcgc
gaccgcagcattgccagtgccgttccggccgccgagaaggccgaccgcggcaatcccgga
cacatcgccgcgccatttgccggagtcgtcacggtcggggtgtgcgtcggcgagcgggtc
ggcgccggccaaaccatcgccaccatcgaggcgatgaagatggaagccccgatcaccgcc
ccggttgccggcaccgtggagcgggtggcggtgtcggacaccgcccaggtggagggcgga
gacctgttggtggtggtgagctga

DBGET integrated database retrieval system