KEGG   Mycobacterium tuberculosis F11: TBFG_13348Help
Entry
TBFG_13348        CDS       T00545                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mtf  Mycobacterium tuberculosis F11
Pathway
mtf00020  Citrate cycle (TCA cycle)
mtf00190  Oxidative phosphorylation
mtf00650  Butanoate metabolism
mtf01100  Metabolic pathways
mtf01110  Biosynthesis of secondary metabolites
mtf01120  Microbial metabolism in diverse environments
mtf01130  Biosynthesis of antibiotics
mtf01200  Carbon metabolism
Module
mtf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mtf_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mtf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TBFG_13348
   00650 Butanoate metabolism
    TBFG_13348
  Energy metabolism
   00190 Oxidative phosphorylation
    TBFG_13348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ABR07673
Position
3716094..3716528
Genome map
AA seq 144 aa AA seqDB search
MSAPVRQRSHDRPASLDNPRSPRRRAGMPNFEKFAWLFMRFSGVVLVFLAIGHLFIMLMW
DNGVYRLDFNFVAQRWASPFWQTWDLLLLWLAQLHGGNGLRTIIDDYSRKDTTRFWLNSL
LVLSMLFTLMLGTYVIVTFDPNIS
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccccggtcagacagcgcagccatgaccgtccagccagcctggacaacccacga
tcaccacggcggcgtgccggcatgcccaacttcgagaaattcgcctggctgttcatgcgg
ttttccggtgttgtgttggtgttcctggcgatcgggcacctgttcatcatgctgatgtgg
gacaacggcgtgtatcgcctggacttcaacttcgttgcccaacgctgggcgtcgccgttc
tggcagacctgggatctgctgttgttgtggctggcgcagctgcacggcggcaacggtctg
cgcaccatcattgacgactacagccgcaaagacaccacccgattctggctgaactcgttg
ctggtgttgtccatgctgttcaccctgatgctgggaacctacgtgatagtgacattcgac
ccgaacatctcctga

DBGET integrated database retrieval system