KEGG   Mycobacterium tuberculosis RGTB327: MRGA327_04815Help
Entry
MRGA327_04815     CDS       T01775                                 

Definition
(GenBank) acylase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
mtg  Mycobacterium tuberculosis RGTB327
Pathway
mtg00430  Taurine and hypotaurine metabolism
mtg00460  Cyanoamino acid metabolism
mtg00480  Glutathione metabolism
mtg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    MRGA327_04815
   00460 Cyanoamino acid metabolism
    MRGA327_04815
   00480 Glutathione metabolism
    MRGA327_04815
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mtg01002]
    MRGA327_04815
Enzymes [BR:mtg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     MRGA327_04815
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     MRGA327_04815
Peptidases and inhibitors [BR:mtg01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   MRGA327_04815
CD molecules [BR:mtg04090]
 Proteins
  MRGA327_04815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AFE15736
Position
complement(866578..867903)
Genome map
AA seq 441 aa AA seqDB search
MPILATNVVCTSQPLAAQAGLRMLADGGNAVDAAVATAITLTVVEPVSNGIGSDAFSIVW
DGQKLHGLNASGRSPSAWTPEYFGGNAVPVLGWNSVTVPGAVSAWVELHARFGRLPFETL
FEPAISYGRNGFLVSPTVAAQWAAQVPLFASQPGFADAFMPGGRAPKPGELFTFPDHAAT
LEKIAATNGEEFYRGELAAKLEAHSAANGGVMRADDLAAHRVDWVDTITGTYRGYTIHQI
PPNGQGIVALIALGILEHFDMSSWSVDSAESVHVQIEALKLAFADAQACVADIDYMPVHP
KRLLDKEYLRQRATLIDPKRAMPAATGIPRGGTVYLAAADAAGMMVSMIQSNYLGFGSGV
VVPGTGISLHNRGSDFTVVPRHPNRVGPRKRPYHTIIPGFVTRDGAPVMSFGVMGGMMQP
QGHVQVLVRHRRLRPEPPGGL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcctggcgacaaacgtcgtgtgcacgtcacaaccgctggccgcgcaagcgggt
cttcggatgctggccgacggcggcaacgcggtcgacgccgccgtcgccacagccatcacc
ctcaccgtggtggaaccggtgtccaatggcatcggctcggacgccttcagcatcgtctgg
gacgggcaaaaactgcacggcctgaacgcgtccggccgctcaccctcggcgtggacgcca
gagtacttcggcggcaacgccgttcccgtgctcggctggaactccgtgacggtgcccggt
gcggtgtcggcctgggtggaactgcacgccaggttcggcaggctaccattcgaaacactc
ttcgagcccgccatctcgtacggccgcaacggctttctggtctcaccgaccgtcgcggca
caatgggcggcacaggtgccgttgttcgcatcccagcccggattcgccgatgcgttcatg
cccggcggacgagcgccgaaacccggtgagctgtttacctttcctgaccacgcggcgacg
ctagagaagatcgcggcgaccaacggtgaggagttctaccggggagagctggccgccaaa
ctcgaggcgcactcggcggcaaacggcggggtgatgcgtgccgacgacctcgccgcccat
cgcgtggactgggtcgacacgatcacgggaacctaccgcgggtacaccatccaccagata
ccgcccaacggccagggcatcgtggccttgatcgccctcggaatcctcgagcatttcgat
atgtcatcgtggtcagtggattccgctgaaagtgtgcacgtgcagatcgaagcactgaag
cttgccttcgccgacgcgcaagcgtgtgtcgccgacatcgactacatgccggtgcacccg
aagcgcctgctcgacaaggagtatctgcggcagcgcgccacgctgatcgatccaaagagg
gcaatgccggcggccaccggcatcccgcgaggcggcaccgtctatctggccgccgccgat
gctgcgggaatgatggtgtccatgattcagtcgaactaccttgggttcggctccggtgtg
gtggtgcccggcaccggcatttcgctgcacaatcgcggctcggatttcactgtggtgccg
agacatccgaaccgggttgggccacggaagcgcccctatcacacgatcatcccaggtttt
gtgacccgcgacggtgcgccggtgatgagcttcggggtgatgggcggcatgatgcaaccc
cagggtcacgtgcaggtgctggtgcgccatcgccgactacggccagaacccccaggcggc
ctgtga

DBGET integrated database retrieval system