KEGG   Mycobacterium tuberculosis RGTB327: MRGA327_09835Help
Entry
MRGA327_09835     CDS       T01775                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
mtg  Mycobacterium tuberculosis RGTB327
Pathway
mtg00780  Biotin metabolism
mtg01100  Metabolic pathways
Module
mtg_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:mtg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    MRGA327_09835
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mtg01007]
    MRGA327_09835
Enzymes [BR:mtg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     MRGA327_09835
Amino acid related enzymes [BR:mtg01007]
 Aminotransferase (transaminase)
  Class II
   MRGA327_09835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Beta_elim_lyase Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AFE16485
Position
1777782..1778942
Genome map
AA seq 386 aa AA seqDB search
MKAATQARIDDSPLAWLDAVQRQRHEAGLRRCLRPRPAVATELDLASNDYLGLSRHPAVI
DGGVQALRIWGAGATGSRLVTGDTKLHQQFEAELAEFVGAAAGLLFSSGYTANLGAVVGL
SGPGSLLVSDARSHASLVDACRLSRARVVVTPHRDVDAVDAALRSRDEQRGVVVTDSVFS
ADGSLAPVRELLEVCRRHGALLLVDEAHGLGVRGGGRGLLYELGLAGAPDVVMTTTLSKA
LGSQGGVVLGPTPVRAHLIDAARPFIFDTGLAPAAVGAARAALRVLQAEPWRPQAVLNHA
GELARMCGVAAVPDSAMVSVILGEPESAVAAAAACLDAGVKVGCFRPPTVPAGTSRLRLT
ARASLNAGELELARRVLTDVLAVARR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgccacgcaggcacggatcgacgattcaccgttggcctggttggacgcggtg
cagcggcagcgccacgaggccggactgcggcgctgcctgcggccgcgtcccgcggtcgcc
accgagctggacttggcctccaacgactatctcggtctgtcccgacatcccgccgtcatc
gacggcggcgtccaggcgctgcggatctggggcgccggcgccaccgggtcgcgcctggtt
accggcgacaccaagctgcaccagcaattcgaggccgagctcgccgagttcgtcggcgct
gccgcgggattgctgttctcctctggctacacggccaacctgggcgccgtggtcggcctg
tccggcccgggttccctgctggtgtccgacgcccgttcgcatgcgtcgttggtggatgcc
tgtcggctgtcgcgggcgcgggttgtggtgacgccgcaccgcgacgtcgacgccgtggac
gccgcgctgcgatcgcgcgacgagcagcgcggcgtcgtcgtcaccgactcggtgttcagc
gccgacggctcgctggcgccggttcgggagttgcttgaggtctgccggcgtcatggtgcg
ctgcttctggtggacgaggcgcacggcctgggtgtgcgtggcggcggacgcgggctgctc
tacgagttaggtctagcgggtgcgcccgacgtggtgatgaccaccacgctgtccaaggcg
ctgggcagccagggtggtgtggtgctcgggccgacgccggtgcgggcccatctgatcgat
gctgcccggccgttcatcttcgacaccggtctggcgccggcggcggtgggtgccgcacgg
gccgcgctgcgcgtcttgcaggccgagccgtggcgaccgcaggcggtgctcaaccacgct
ggtgaacttgcgcggatgtgcggtgtggctgcggtgccggactcggcgatggtgtcggtg
atcctgggcgagccggagtcggcagtggccgccgcggcggcctgcctggacgccggggtc
aaggtgggctgcttccggccgccgacggtgcccgcgggtacgtcgcggctgcggctgacc
gcgcgcgcatcgctgaacgccggcgagctcgagctggcccggcgggtgctgacggatgtt
ctcgccgtggcgcgccgttga

DBGET integrated database retrieval system