KEGG   Mycobacterium tuberculosis RGTB327: MRGA327_11950Help
Entry
MRGA327_11950     CDS       T01775                                 

Definition
(GenBank) riboflavin biosynthesis protein RibA
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
mtg  Mycobacterium tuberculosis RGTB327
Pathway
mtg00740  Riboflavin metabolism
mtg00790  Folate biosynthesis
mtg01100  Metabolic pathways
mtg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    MRGA327_11950
   00790 Folate biosynthesis
    MRGA327_11950
Enzymes [BR:mtg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     MRGA327_11950
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     MRGA327_11950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AFE16817
Position
2187866..2188927
Genome map
AA seq 353 aa AA seqDB search
MKTTDVRVRRAITAMAGGHAVVLTGDPNGDGYLVFAAQAATPRLVAFAVRHTSGYLRVAL
PGAECERLHLPPMCDRDTTHCVSVDVRGTGTGISASDRAWTIAALASATSVAADFQRPGH
VVPVQAQADGVLGRRGPAEAAVDLARLAERRPAAALCEIVSPDNPVQMAHHAESVEFAVE
HGLAMVSIGELVAYRRRIEPQVVRFTAATLPTWAGASRVIGFRDVYDLGEHLAVIVGAVG
AGVPVPLHVHIECLTGDVFGSTACRCGEELNGALARMSAQGSGVVLYLRPPGPAQACGLF
ARGDAATDVMPETVTWILRDLGVYAIRLSDDVPGFGLVMFGAIREASTLAAAG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgaccgatgtgcgggtacgtcgtgcgatcacggcgatggcgggcggtcacgcc
gtggtcctgaccggcgaccccaatggcgatggctatctcgtcttcgccgcccaggccgcg
acgccgcggctggttgcctttgcggtccggcacacctcgggttatttgcgcgtcgcgctg
ccgggcgccgaatgcgagcgactgcacctgccgcccatgtgtgaccgagacaccacgcat
tgcgtgtcggtcgacgttcgcggcaccggcaccggaatctcggcgagcgatcgcgcctgg
accatcgcggcactggcttcggccacctccgtcgccgccgatttccaacgtccgggccat
gtggtgcccgtgcaggcgcaagccgacggtgtgctgggtcggcggggacccgccgaggcg
gccgtcgacctggcccgcctggcggaacggcggccggccgccgcgctctgcgagatcgtc
tcgcccgataatcccgtccagatggcgcaccacgccgagtcggtcgaattcgccgtcgaa
cacggactggccatggtctcgatcggggagctggtggcgtatcgccggcggatcgagccc
caggtggtccggtttacggcagcgacgctgcccacctgggccggcgcctcgcgtgtcatc
ggctttcgtgacgtttacgacctcggcgagcatttggcggtcatcgtgggtgcggtcggt
gccggggtgcccgtgccgctgcacgtccacatcgagtgcctgacgggcgacgtgttcggc
tcgacggcgtgccgctgcggcgaggaactcaacggcgcgctggcgaggatgtcggctcag
ggcagcggcgtggtcttgtatctgcgtccgcccggacccgcgcaagcgtgcggcttgttc
gcccggggcgatgcggcgaccgatgtcatgccggagaccgtgacatggatcctgcgcgat
cttggggtgtatgcgatccgactttccgatgatgtgccaggatttgggcttgtcatgttc
ggggcgatccgagaagccagcacgttggcggccgcaggttga

DBGET integrated database retrieval system