KEGG   Mycobacterium tuberculosis RGTB327: MRGA327_16575Help
Entry
MRGA327_16575     CDS       T01775                                 

Definition
(GenBank) polyphosphate glucokinase ppgK
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
mtg  Mycobacterium tuberculosis RGTB327
Pathway
mtg00010  Glycolysis / Gluconeogenesis
mtg00520  Amino sugar and nucleotide sugar metabolism
mtg01100  Metabolic pathways
mtg01110  Biosynthesis of secondary metabolites
mtg01120  Microbial metabolism in diverse environments
mtg01130  Biosynthesis of antibiotics
mtg01200  Carbon metabolism
Module
mtg_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mtg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MRGA327_16575
   00520 Amino sugar and nucleotide sugar metabolism
    MRGA327_16575
Enzymes [BR:mtg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     MRGA327_16575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AFE17528
Position
3010630..3011427
Genome map
AA seq 265 aa AA seqDB search
MTSTGPETSETPGATTQRHGFGIDVGGSGIKGGIVDLDTGQLIGDRIKLLTPQPATPLAV
AKTIAEVVNGFGWRGPLGVTYPGVVTHGVVRTAANVDKSWIGTNARDTIGAELGGQQVTI
LNDADAAGLAETRYGAGKNNPGLVVLLTFGTGIGSAVIHNGTLIPNTEFGHLEVGGKEAE
ERAASSVKEKNDWTYPKWAKQVTRVLIAIENAIWPDLFIAGGGISRKADKWVPLLENRTP
VVPAALQNTAGIVGAAMASVADTTH
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcaccggccccgagacgtccgaaacaccgggtgccacgacacagcgtcatggc
ttcggcatcgacgtcggcggcagcggcatcaagggcggaatcgtcgacttggacaccggc
cagctgatcggcgaccggatcaagctgctgaccccgcaaccggccactccgttggcggtc
gccaaaaccatcgccgaggtcgtcaacggtttcggctggcggggtccgctgggggtgacc
tatcccggcgtcgtcactcacggcgtcgtccggaccgcggctaacgtggacaagtcctgg
atagggaccaacgcacgcgacactatcggcgccgagctgggcggtcagcaggtcaccatc
ctcaacgacgctgatgccgccgggctggccgagacacgctacggggccggcaagaacaac
cctggcttagtggtactgctcacattcggaaccgggatcgggtccgcggtcatccacaac
gggacgttgatacccaacaccgagttcggacatcttgaggtcggcggcaaggaagcggag
gaaagggccgcctcctcggtaaaggaaaagaacgactggacctatccaaagtgggccaag
caggtgacacgcgtgctcatcgccatcgagaacgcgatctggcctgacctgttcatcgcc
ggcggcggcatcagccgcaaggccgacaaatgggtgccgctactggaaaaccgcacacca
gtagtgcccgcggccctgcagaacaccgccggaattgtcggtgcggccatggcctctgtc
gcagatacgacgcactga

DBGET integrated database retrieval system