KEGG   Mycobacterium tuberculosis RGTB327: MRGA327_20435Help
Entry
MRGA327_20435     CDS       T01775                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mtg  Mycobacterium tuberculosis RGTB327
Pathway
mtg00020  Citrate cycle (TCA cycle)
mtg00190  Oxidative phosphorylation
mtg00650  Butanoate metabolism
mtg01100  Metabolic pathways
mtg01110  Biosynthesis of secondary metabolites
mtg01120  Microbial metabolism in diverse environments
mtg01130  Biosynthesis of antibiotics
mtg01200  Carbon metabolism
Module
mtg_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mtg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MRGA327_20435
   00650 Butanoate metabolism
    MRGA327_20435
  Energy metabolism
   00190 Oxidative phosphorylation
    MRGA327_20435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: AFE18113
Position
3698618..3699052
Genome map
AA seq 144 aa AA seqDB search
MSAPVRQRSHDRPASLDNPRSPRRRAGMPNFEKFAWLFMRFSGVVLVFLAIGHLFIMLMW
DNGVYRLDFNFVAQRWASPFWQTWDLLLLWLAQLHGGNGLRTIIDDYSRKDTTRFWLNSL
LVLSMLFTLMLGTYVIVTFDPNIS
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccccggtcagacagcgcagccatgaccgtccagccagcctggacaacccacga
tcaccacggcggcgtgccggcatgcccaacttcgagaaattcgcctggctgttcatgcgg
ttttccggtgttgtgttggtgttcctggcgatcgggcacctgttcatcatgctgatgtgg
gacaacggcgtgtatcgcctggacttcaacttcgttgcccaacgctgggcgtcgccgttc
tggcagacctgggatctgctgttgttgtggctggcgcagctgcacggcggcaacggtctg
cgcaccatcattgacgactacagccgcaaagacaccacccgattctggctgaactcgttg
ctggtgttgtccatgctgttcaccctgatgctgggaacctacgtgatagtgacattcgac
ccgaacatctcctga

DBGET integrated database retrieval system