KEGG   Mycobacterium tuberculosis RGTB327: MRGA327_21960Help
Entry
MRGA327_21960     CDS       T01775                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtg  Mycobacterium tuberculosis RGTB327
Pathway
mtg00071  Fatty acid degradation
mtg00072  Synthesis and degradation of ketone bodies
mtg00280  Valine, leucine and isoleucine degradation
mtg00310  Lysine degradation
mtg00362  Benzoate degradation
mtg00380  Tryptophan metabolism
mtg00620  Pyruvate metabolism
mtg00630  Glyoxylate and dicarboxylate metabolism
mtg00640  Propanoate metabolism
mtg00650  Butanoate metabolism
mtg00900  Terpenoid backbone biosynthesis
mtg01100  Metabolic pathways
mtg01110  Biosynthesis of secondary metabolites
mtg01120  Microbial metabolism in diverse environments
mtg01130  Biosynthesis of antibiotics
mtg01200  Carbon metabolism
mtg01212  Fatty acid metabolism
mtg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mtg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MRGA327_21960
   00630 Glyoxylate and dicarboxylate metabolism
    MRGA327_21960
   00640 Propanoate metabolism
    MRGA327_21960
   00650 Butanoate metabolism
    MRGA327_21960
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MRGA327_21960
   00072 Synthesis and degradation of ketone bodies
    MRGA327_21960
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MRGA327_21960
   00310 Lysine degradation
    MRGA327_21960
   00380 Tryptophan metabolism
    MRGA327_21960
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MRGA327_21960
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MRGA327_21960
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MRGA327_21960
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtg04147]
    MRGA327_21960
Enzymes [BR:mtg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MRGA327_21960
Exosome [BR:mtg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MRGA327_21960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFE18348
Position
complement(3964164..3965324)
Genome map
AA seq 386 aa AA seqDB search
MTEAYVIDAVRTAVGKRGGALAGIHPVDLGALAWRGLLDRTDIDPAAVDDVIAGCVDAIG
GQAGNIARLSWLAAGYPEEVPGVTVDRQCGSSQQAISFGAQAIMSGTADVIVAGGVQNMS
QIPISSAMTVGEQFGFTSPTNESKQWLHRYGDQEISQFRGSELIAEKWNLSREEMERYSL
TSHERAFAAIRAGHFENEIITVETESGPFRVDEGPRESSLEKMAGLQPLVEGGRLTAAMA
SQISDGASAVLLASERAVKDHGLRPRARIHHISARAADPVFMLTGPIPATRYALDKTGLA
IDDIDTVEINEAFAPVVMAWLKEIKADPAKVNPNGGAIALGHPLGATGAKLFTTMLGELE
RIGGRYGLQTMCEGGGTANVTIIERL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgacagaggcgtacgtcatcgacgccgtacggaccgcggtcggcaagcggggcggcgca
ctggccggtatccatcccgtcgacctgggtgccctggcctggcgcggcctgctggaccgg
accgacatcgaccccgccgccgtcgacgacgtgatcgccggatgtgtcgacgccatcggc
ggacaggcgggcaacatcgcccgactgtcgtggctggccgccggctatcccgaagaggtc
cccggtgtcaccgtggaccgccagtgcggatccagccagcaggcgatttcctttggcgcg
caggcgatcatgtccggcacggcggatgtcatcgtggccggcggcgtgcagaacatgagc
cagatcccgatctcgtcggcgatgaccgtgggcgaacagttcgggttcacctcgccgacc
aacgaatccaagcaatggttacaccggtatggcgaccaggagatttcacagttccgtggc
tcggagctgatcgccgagaagtggaacctgtcccgtgaagagatggagcggtactcgctg
accagccacgaacgcgcgttcgcggcgatccgcgccggccacttcgaaaacgaaatcatc
actgtggaaaccgaatccgggccgttccgggttgatgagggcccgcgggagtcgtcgctg
gagaagatggccggcttgcagccgctggtcgagggcggccggctgacggcggcgatggcc
agtcagatctccgacggcgccagtgcagtgttgctggcctccgagcgggccgtcaaagac
catggacttaggccccgtgcccgcatccaccacatcagtgcgcgcgccgccgacccggta
ttcatgctgaccggacccatccccgccacccggtacgcgctggacaagaccgggcttgcc
atcgacgacatcgacaccgtcgagatcaacgaggcgttcgcgccggtagttatggcctgg
ctcaaggaaatcaaggccgacccggcgaaggtcaaccccaacggcggcgcgatcgcgctg
gggcatccgctaggcgccaccggcgccaaactgttcaccaccatgctgggcgagctggag
cgcatcggtggccgctacgggctgcagaccatgtgcgagggcggcggcaccgccaacgtc
accattatcgagcggctgtag

DBGET integrated database retrieval system