KEGG   Mycobacterium tuberculosis RGTB327: MRGA327_22035Help
Entry
MRGA327_22035     CDS       T01775                                 

Definition
(GenBank) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase
  KO
K16050  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase [EC:3.7.1.17]
Organism
mtg  Mycobacterium tuberculosis RGTB327
Pathway
mtg00984  Steroid degradation
mtg01100  Metabolic pathways
mtg01120  Microbial metabolism in diverse environments
mtg01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mtg00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    MRGA327_22035
Enzymes [BR:mtg01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.17  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase
     MRGA327_22035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4
Motif
Other DBs
NCBI-ProteinID: AFE18361
Structure
PDB: 

Position
complement(3978556..3979233)
Genome map
AA seq 225 aa AA seqDB search
MCWPSTSPVTAIPTSGPSTATFNRYAAMALKGLFDQLGLGRVPLVGNSLGGGTAVRFALD
YPARAGRLVLMGPGGLSINLFAPDPTEGVKRLSKFSVAPTRENLEAFLRVMVYDKNLITP
ELVDQRFALASTPESLTATRAMGKSFAGADFEAGMMWREVYRLRQPVLLIWGREDRVNPL
DGALVALKTIPRAQLHVFGQCGHWVQVEKFDEFNKLTIEFLGGGR
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgtgctggccgtcgaccagcccggttacggccattccgacaagcgggccgagcacggcc
acgttcaatcgctatgccgcgatggcgctgaaggggctcttcgatcagctggggctgggg
cgggtaccgctggtgggcaactcgttgggcgggggaaccgcggtccggtttgcgctggac
tacccggcccgggcaggacggttagtgctgatgggcccggggggcctgagtatcaacctg
tttgcgcccgacccgaccgagggagtcaaacggctgtcgaagttctccgttgcgcccacc
cgggagaacctcgaggcgttcctgcgggtcatggtctacgacaagaacctgatcaccccc
gagttggtggatcagcggtttgcgctggccagcaccccggagtcgttgacggcaacacgg
gcgatgggaaagtcgttcgccggagccgacttcgaggccggcatgatgtggcgcgaggtg
tatcggctgcgccagccggtgttgctgatctggggtcgtgaggaccgggtcaacccgctg
gacggcgcgctggttgcgttgaaaacgattccgcgtgcgcagctgcacgtattcgggcag
tgtgggcattgggtgcaggtggagaagttcgacgagttcaacaagctgacgattgaattt
ctgggaggtggcagatga

DBGET integrated database retrieval system