KEGG   Methanothermobacter thermautotrophicus: MTH_1163Help
Entry
MTH_1163          CDS       T00009                                 

Definition
(GenBank) N5-methyl-tetrahydromethanopterin:coenzyme M methyltransferase, subunit E
  KO
K00581  tetrahydromethanopterin S-methyltransferase subunit E [EC:2.1.1.86]
Organism
mth  Methanothermobacter thermautotrophicus
Pathway
mth00680  Methane metabolism
mth01100  Metabolic pathways
mth01120  Microbial metabolism in diverse environments
mth01200  Carbon metabolism
Module
mth_M00357  Methanogenesis, acetate => methane
mth_M00567  Methanogenesis, CO2 => methane
mth_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mth00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MTH_1163
Enzymes [BR:mth01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     MTH_1163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrE T4BSS_DotI_IcmL
Motif
Other DBs
NCBI-ProteinID: AAB85652
UniProt: O27231
Position
complement(1070113..1071000)
Genome map
AA seq 295 aa AA seqDB search
MDPMITGLGVVALMGAAATIAGAAEDLESDVGSQSNPNSQVQLAPQMGHLHRIINKAVSG
EPVAYGTWCGIAGSVAYVLMQSMQLPVIMAIAVGAVIAAMVHTTYAVTSHMGRIVSQSQF
NQPLFMDMLVQHLGPIAGHGFIVTFCIVGLSYLMTLPIPGFAHPFPLPLLAVLWGITIGA
IGSSTGDVHYGAEREYQQYPFGGGIPVAIHGDITTKAELGARNSMDVVHFCAKYGGPLTG
FAFGAIVFLSFWNTIVFGITGGIISGLIIVLLLIILNNRLEVFARNRYGPYKEDE
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggaccctatgataacaggtttaggtgttgtagctctcatgggtgcagctgcaaccata
gcaggagccgcagaggacttagagtctgacgtaggatcccagagtaaccccaactcacag
gttcagctggcaccacagatgggacacctgcaccgtataatcaacaaggccgtttcaggg
gaacccgttgcctacgggacctggtgcggaattgctggttcagttgcatatgtgctgatg
cagtcaatgcagctgcctgtgataatggcaattgcagttggcgctgtaatcgccgcaatg
gtacacacaacctacgctgtaacatcccacatgggacgaattgttagccagtcccagttc
aaccagccactcttcatggacatgctggttcagcacttaggcccaattgcagggcatgga
tttattgtgacattctgtattgtaggattatcatacctcatgacactaccaatccctggc
tttgcacacccattcccgctgccacttctggcagtgctctggggtataacaataggtgca
atcggttcatcaacaggggacgtccactacggtgctgaaagggagtaccagcagtacccc
ttcggtggaggtatcccggttgcgattcacggtgacataacaacaaaggcagagctgggt
gcaaggaactcaatggacgttgttcacttctgtgcaaagtacggcggacccttaacagga
ttcgcattcggtgcaatcgtattcctcagcttctggaacacaatagtcttcggtataacc
ggcggaataatatccggcctcataatagtcttgttactgataatcctcaacaacagactt
gaagtctttgcaagaaacagatatggaccatacaaggaggatgaatag

DBGET integrated database retrieval system