KEGG   Methanothermobacter thermautotrophicus: MTH_129Help
Entry
MTH_129           CDS       T00009                                 

Definition
(GenBank) orotidine 5' monophosphate decarboxylase
  KO
K01591  orotidine-5'-phosphate decarboxylase [EC:4.1.1.23]
Organism
mth  Methanothermobacter thermautotrophicus
Pathway
mth00240  Pyrimidine metabolism
mth01100  Metabolic pathways
Module
mth_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:mth00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    MTH_129
Enzymes [BR:mth01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.23  orotidine-5'-phosphate decarboxylase
     MTH_129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase
Motif
Other DBs
NCBI-ProteinID: AAB84635
UniProt: O26232
Structure
PDB: 

Position
complement(83589..84275)
Genome map
AA seq 228 aa AA seqDB search
MRSRRVDVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFR
KRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFRGADSVRACLNVAEEMGREV
FLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISP
GVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLLNP
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
ttgagatcccggagagttgatgttatggacgttatgaacagacttatacttgcaatggac
ctcatgaaccgggatgatgccctcagggtcaccggagaggtcagggaatacatagacacg
gtcaagatagggtacccccttgtactctcagagggtatggatatcattgctgagttcaga
aagagatttggctgcagaatcatagccgacttcaaggttgcagatatacccgagaccaat
gaaaagatatgccgggccaccttcaaggcgggggctgatgccataatagtccacggattc
cggggagcagacagtgtcagggcctgcctcaatgtcgcagaggaaatgggacgtgaggtc
ttcctcctgacagagatgtcacacccaggggcagagatgttcatacagggcgctgcagat
gaaatagccagaatgggggtcgatcttggtgtcaaaaattatgttggcccatccacaaga
cctgaaaggctttcaaggctgagggaaatcataggtcaggattcatttctcatatccccc
ggtgtgggagcccagggaggagacccaggggagaccctcaggttcgcagatgccataata
gttggaagatccatctaccttgcagataaccctgcagctgcagcagcagggataatagaa
tccattaaagaccttctgaatccctga

DBGET integrated database retrieval system