KEGG   Methanothermobacter thermautotrophicus: MTH_1675Help
Entry
MTH_1675          CDS       T00009                                 

Definition
(GenBank) conserved protein
  KO
K09126  uncharacterized protein
Organism
mth  Methanothermobacter thermautotrophicus
Brite
KEGG Orthology (KO) [BR:mth00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    MTH_1675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK_C
Motif
Other DBs
NCBI-ProteinID: AAB86147
UniProt: O27711
Structure
PDB: 

Position
1534683..1535243
Genome map
AA seq 186 aa AA seqDB search
MEKKICYFEEPGKENTERVLELVGERADQLGIRNFVVASVSGETALRLSEMVEGNIVSVT
HHAGFREKGQLELEDEARDALLERGVNVYAGSHALSGVGRGISNRFGGVTPVEIMAETLR
MVSQGFKVCVEIAIMAADAGLIPVDEEVIAIGGTAWGADTALVLTPAHMNSVFDLRIHEV
IAMPRP
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaagatatgctactttgaggaaccaggtaaggaaaatacagagagggtcctt
gaacttgtaggggagagggctgaccagctcggaatcaggaattttgttgtggcatctgtt
tcaggtgagacagccctgagattatctgaaatggttgaaggtaacattgtatcagtaacc
catcatgcaggtttcagggagaagggtcaacttgaactggaggacgaggcaagggatgcg
ctccttgagaggggtgtgaatgtttatgcgggttcacatgccctcagtggcgttggaaga
gggatatcaaacaggtttggtggtgtcacacccgtggagataatggctgaaaccctgagg
atggtctcccagggattcaaggtatgtgttgagatagccataatggctgcagatgctggc
ctcatccccgttgatgaagaggttatagccataggtgggacagcatggggtgctgacacc
gcccttgtactcacacccgcccatatgaacagtgtattcgacctcaggatccatgaggta
attgccatgcccaggccataa

DBGET integrated database retrieval system