KEGG   Microbulbifer thermotolerans: A3224_11165Help
Entry
A3224_11165       CDS       T04393                                 

Definition
(GenBank) 23S rRNA methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
mthd  Microbulbifer thermotolerans
Brite
KEGG Orthology (KO) [BR:mthd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mthd03009]
    A3224_11165
Enzymes [BR:mthd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     A3224_11165
Ribosome biogenesis [BR:mthd03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    A3224_11165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_23 Methyltransf_12 Ubie_methyltran Methyltransf_4 MTS Methyltransf_9 CMAS MetW Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: AMX03051
UniProt: A0A143HNH3
Position
complement(2660109..2660915)
Genome map
AA seq 268 aa AA seqDB search
MIWQCPVCQLPLQCDDTRWHCANHHSYDCAREGYVNLLPANRKRSKDPGDSAEMLRARRR
FLDAGYYRPLVEAVTALLPYTPGRQLLDIGCGEGYYLRALEAAGWPSQALAGVDIAKAGV
RLAAKRMPDVQFVVASSVELPLAQDSVDHLLRIFAPAADSEMRRVLNPGGSLLDVSPGPE
HLWSLKAALYDEPRLHPPPGRVDGFVPEMEVRCCFPFRVQGREAIADFLMMTPFAWKGSR
DMRRQLEQQDSLNLEADFVVRRLVATEP
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgatctggcaatgtcctgtctgtcagctgccgttgcagtgcgatgatacgcgctggcat
tgcgccaaccatcacagctatgactgtgcccgagagggctatgtgaacctgctgccggcc
aaccgaaaacgcagcaaagaccccggtgattccgcggaaatgttgcgcgcgcggcgccgc
tttctcgacgcgggttactatcgcccgctggttgaggcggtgacggcgctactgccatac
actcccggtcgacaattactggatattggctgtggcgaggggtattacctccgcgcactc
gaggccgcaggctggccgtcgcaggcactggcgggcgtggatattgccaaggccggcgtg
cgtctggcagccaagcgcatgccggatgttcagtttgtggtggccagcagtgtggagcta
cctttggcgcaggacagtgtcgaccacttgctgcgaatcttcgctccagctgcggacagt
gaaatgcgccgggtgctgaatccgggcggttcactgttggatgtatctccggggccggag
cacctctggtcactgaaggcggccctctacgacgagccgcgcctccatccaccgcccggg
cgggtggacggatttgtaccggaaatggaagtccgttgctgctttccatttcgggttcag
gggcgtgaggcgatcgcggattttctgatgatgactcctttcgcttggaaaggcagccgg
gatatgcgccgccagctggaacagcaagacagtctgaatctggaagcggactttgtggtg
cgccgcctggtcgctacggaaccttag

DBGET integrated database retrieval system