KEGG   Microbulbifer thermotolerans: A3224_11175Help
Entry
A3224_11175       CDS       T04393                                 

Definition
(GenBank) beta-hexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
mthd  Microbulbifer thermotolerans
Pathway
mthd00511  Other glycan degradation
mthd00520  Amino sugar and nucleotide sugar metabolism
mthd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mthd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    A3224_11175
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    A3224_11175
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mthd03110]
    A3224_11175
Enzymes [BR:mthd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     A3224_11175
Chaperones and folding catalysts [BR:mthd03110]
 Intramolecular chaperones
  Others
   A3224_11175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 CHB_HEX CHB_HEX_C Glyco_hydro_20b
Motif
Other DBs
NCBI-ProteinID: AMX03052
UniProt: A0A143HP48
Position
complement(2662983..2665706)
Genome map
AA seq 907 aa AA seqDB search
MIRVPLISALLLAALLSACDRSGGFPAPTGSERLSSAERIARDFLVTQEVLTNFQGVDER
LRTECKRAGGSGAICSSYRISLINQGEAIRPGEGDWAIYFHSIRRSLRLLNRDDFTLEHI
KGDLHRLTPTEAFTGIAEGETLAFDLLAEYWMQSESDFMPRLFVVDGAGKAHVIASTDSD
SIEGLALPITSHHPENWKRTADDANTLATPASRYAAFSTRQPDGGESWRTRIIPRPQLLE
VTGEPVRLRTGIAVDAGPLESRSLHAFRQRLEQLGLAPSGPGAYPVRVDIEPEAFREKVA
GAYTLQTKARGARIIGRDQAGAFYGLQSLLALVDLRSQTLARVRVEDAPRFPHRGFSLDV
GRNFHSKAVVLKLLDQMAAYKLNRFHFHLSDDEGWRLEIPGLSELTEVGARRCFDPGETR
CLLPQLGSGPKSDNSGSGFFTVEDYIHIVRYAAARHIEVIPEFDMPAHARAAVVAMEARY
RKLADESAQRAAEYRLIDPQDDTQYLSVQFYDDSYINPCIDSTYHFIGKLIREVQAMHRA
AGAPLASWHFGGDEALNILAGNGFEDAPGSDPDKGDVASVKRQMPWSESPACQKLVPKGE
VEDLGQLGAFFAKRVSRLVAEAGIPTLAAWSDGVKHIENAGEMLATKRNYANAWTPLFWG
GGAESVRLADAGFGVVQSHADFLYFDMPYELDPKESGYYWASRSTDTRKAFSYAPLNTAQ
LAEISTDRDGRGWSAMSPAPEFEKSVQGIQGQLWSEVVRTDAQVEYMLFPRLLALAERAW
HRAEWELPLAEGQNFSARTAAVDKASLDADWNGFAAALGNRELLKLDLSGIAYRIPVPGV
VVEDGALKTALPYPGLPLEYFDGERWRELETSVSADAVWAVRARSADGRRTGRAAILRAL
PAANAQR
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atgatccgtgttcccttgatatccgcactgcttctggccgcgcttttatctgcctgcgac
cggtccggcggctttcccgctccgaccggcagtgaacgactttcctccgcagagcggatt
gcgcgcgattttttggtaactcaagaggtgcttacaaacttccagggggtggatgaacgg
ctgcgcactgagtgcaaacgcgctggcggcagcggtgccatctgctcaagctatcgcatt
tcgctaatcaatcagggcgaggcaatccggcccggagaaggcgattgggccatttacttt
cacagcatccgccgcagtctgcgtctgttgaaccgggatgacttcacgctcgagcacatc
aagggtgatctgcaccggctgacgcccaccgaggcgtttaccggcatcgccgagggtgag
acgctggcctttgacctactggcggaatattggatgcagtctgaatcggatttcatgccg
cgcctgttcgtggttgatggggccggtaaggcccatgtcattgcttctactgacagcgat
agtattgaagggttggcgctgccgatcacctctcatcatccggaaaattggaaacgcact
gccgacgatgccaatacactggccacccccgccagtcgctatgctgctttcagcacaaga
caaccggacggcggagaatcctggcgcacgcgcataattccacggccgcaattattggaa
gtaacgggagaaccggtgcgcctccgaactggcatcgcggtggacgcgggacctctggag
agcaggagcctgcacgcttttcgccagcggcttgagcagctggggctggcaccctccggc
cccggggcttacccggtgcgggtggacatagaaccggaagccttcagggaaaaggtcgcg
ggcgcttacactctacagacgaaagcgcgcggtgcgcggattattggccgagatcaggcc
ggcgctttttacggcctgcagtcccttttggcactggtggatctgcgcagccagacactg
gcgcgggtgcgggtggaagatgcgccacgttttcctcatcgcggattttctctcgacgta
gggcgcaactttcacagtaaggcggtggtgttgaagttgctggatcagatggcggcctac
aagctcaaccgttttcacttccacttgtctgacgacgaggggtggcgtcttgaaataccc
ggcctgtctgaattgacggaagtgggggccaggcgctgtttcgaccccggtgaaacccgc
tgtctgcttcctcagctgggttcgggtccaaaatccgacaacagcggcagcggcttcttt
actgtcgaagactatatccacatcgtgcgctatgccgctgcacgccatattgaagtgatt
cccgagttcgacatgcccgctcacgcacgcgccgcggtggtggcgatggaagcgcgctac
agaaaactggccgatgaatccgcacagagggcggctgagtaccgattgattgatccacag
gacgatacgcaatacctgtcggtacagttctacgacgacagctacatcaatccgtgtatc
gactctacctaccactttattggcaagttgatccgggaagtgcaagcgatgcaccgggca
gccggtgctccgctggccagctggcacttcggtggcgatgaagcgttgaatatccttgct
ggcaatggcttcgaggatgctcccggcagcgatccagacaagggcgatgtggcatcggtg
aagcgccagatgccgtggagcgagtcgccagcctgtcagaaactcgtgcccaagggcgaa
gtggaggatctcgggcagttgggtgccttcttcgccaagcgggttagccgcctggtggcc
gaagccggtattcccactctcgcggcttggagtgatggcgtaaaacatatagagaatgcc
ggtgagatgctggccaccaagcgaaattatgccaatgcctggacaccgctgttctggggc
ggcggtgctgaaagtgtgcgcttggcagatgcagggtttggagtggtgcagtcccacgcg
gattttctttatttcgacatgccctacgagctggatcccaaagagagcggctattactgg
gcctcgcgctcaacagacacccgtaaagcgttcagctatgcgccgctgaacaccgcgcaa
ctggcggaaatttcaactgatcgcgatggcaggggctggtcggcgatgtcaccggcgcca
gagtttgagaagagtgtgcagggtattcaggggcagctgtggagcgaggtggtgcgcact
gatgcccaggtggagtacatgctatttccgcgccttttggctttggcggaacgcgcctgg
caccgggcggaatgggagctgccgctggcggaaggacagaatttttccgcccggaccgca
gctgtcgataaggcatcgctcgacgctgactggaacggattcgctgcggcgctggggaac
agggagttgctcaagctggatttgagcggcatcgcttatcgtataccggtgcccggtgta
gtggtggaagatggggcactgaaaaccgcgctgccttatccgggattgccactggagtat
ttcgacggcgaaagatggcgggaactggaaacgagtgtttcggcagatgcggtatgggcg
gtgcgcgcccgcagtgccgacggccgccgcactgggcgcgcggcgattttgcgggcgctg
cctgcggcgaatgcgcaacgttga

DBGET integrated database retrieval system