KEGG   Microbulbifer thermotolerans: A3224_13325Help
Entry
A3224_13325       CDS       T04393                                 

Definition
(GenBank) cellobiohydrolase
  KO
K19668  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
mthd  Microbulbifer thermotolerans
Pathway
mthd00500  Starch and sucrose metabolism
mthd01100  Metabolic pathways
mthd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mthd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A3224_13325
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A3224_13325
Enzymes [BR:mthd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     A3224_13325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_6
Motif
Other DBs
NCBI-ProteinID: AMX04257
UniProt: A0A143HS06
Position
complement(3224471..3225700)
Genome map
AA seq 409 aa AA seqDB search
MDNPFAASSSWYVNPEWSANASSEPGGSAIANYSTAVWMDRIAAITEGVGLRGHLDQALA
NGNDLFTFVVYNLPNRDCAALASNGELLISENGFERYKLEYIDPIVEILSDPAYADINIV
AVIEVDSLPNLVTNLSTPECQEANGPGGYRDGIRYALNQLSTLPNVYSYVDIGNSGWLGW
SSNFGPAVSLIGDLIETTDKGWNSVAGFVSNTSNYAPVEEPFLPDPTLTVGGQPIRSADF
YEWNDYLEELDFVQDWRQAMIDRGAPETIGMLIDTGRNGWGGPDRPTGVSASLDVNTYVN
ESRIDRREHRGNWCNQPGGVGFRPQANPHPGVDAYVWVKPPGESDGIADPNFEQDPNDPN
KKHDPMCDPNASNRYDGSVSTGALPNAPHAGGWFPEGFQVLLENAYPPL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
ctggataatccattcgccgcttccagcagctggtacgtaaatccggagtggtcggccaat
gcgtcgtcggagccgggcggcagtgccatcgccaactacagtaccgcagtatggatggat
cgtatcgcagctatcacagaaggcgtgggactgcgcggccacctcgaccaagcactggcc
aatggcaacgatctgtttacttttgtggtttacaacctgccgaaccgcgattgcgcggcg
ctggcttccaacggtgagttgttgatttccgagaatggattcgagcgttacaaactggaa
tacatcgatccgatcgtggagatactctccgatcccgcctacgcggatatcaatattgtc
gctgttatcgaagtggattcactgccgaacttggtgaccaacctgagtacgccggagtgt
caggaggccaatggtccgggaggttaccgcgacggtattcgctacgcgttaaatcagctc
tccacattgcctaatgtctattcctatgtcgatattggtaattccggatggctcggctgg
agcagcaactttggtccagcagtatctttgattggtgatctgattgaaaccaccgacaag
ggctggaacagtgtggcaggtttcgtcagcaacacctccaattacgcaccggttgaggag
cccttcctgcctgatcccactttgactgtaggtggccagccaatccgctctgcggatttt
tacgagtggaacgattatctcgaggagctggatttcgttcaggactggcgccaggcgatg
atcgaccgcggtgcgcctgaaacgatcggtatgctgattgacaccggccgtaatggctgg
ggtggcccggaccgacccactggcgtgtccgccagcctggatgtgaacacttacgtgaac
gaatcacgtatcgaccggcgcgaacatcgcggcaattggtgcaaccagcccggcggtgtc
ggcttccggcctcaggccaatccgcacccgggtgtggacgcctatgtatgggtcaaacca
ccgggtgagtctgatggtatcgcggatccgaatttcgaacaggacccgaacgatcccaac
aagaaacatgatcccatgtgcgacccgaatgcatccaaccgctacgacggcagtgtgagc
acgggtgcattgcccaatgcgcctcatgcgggcggctggttcccggagggcttccaggta
ttgctggaaaacgcctatccaccgctttaa

DBGET integrated database retrieval system