KEGG   Microbulbifer thermotolerans: A3224_14100Help
Entry
A3224_14100       CDS       T04393                                 

Gene name
gcvT
Definition
(GenBank) glycine cleavage system protein T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
mthd  Microbulbifer thermotolerans
Pathway
mthd00260  Glycine, serine and threonine metabolism
mthd00630  Glyoxylate and dicarboxylate metabolism
mthd00670  One carbon pool by folate
mthd01100  Metabolic pathways
mthd01110  Biosynthesis of secondary metabolites
mthd01130  Biosynthesis of antibiotics
mthd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mthd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    A3224_14100 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A3224_14100 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    A3224_14100 (gcvT)
Enzymes [BR:mthd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     A3224_14100 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: AMX03557
UniProt: A0A143HPY8
Position
complement(3418974..3420062)
Genome map
AA seq 362 aa AA seqDB search
MGNKTPLYDTHVAMGGKMVDFGGWDMPLHYGSQLEEHEKVRTDAGMFDVSHMTVVDIDGD
GARDYLRYLLANDVAKLDGVTGKALYTGMLNEKGGVIDDLIVYLKESGYRVVVNCATREK
DLEWMSRQAEAFDVSLSERPELAMVAIQGPNAIDKVKQVMGIEWVSAIDNLKVFQSVARG
DWFVARTGYTGEDGLEIMLSGEDAPGFWRALADAGVAPCGLGARDTLRLEAGMNLYGHEM
DEDTSPLVANMGWTIAWQPEDRDFIGRTALEEEKAQGVKEKLVGLVLKERGVLRAGQPVV
VDGSEERGIITSGTFSPTLGYSIALARVPVSVGDTAQVEMRKKLVSVKVVKPCFVRNGKS
VI
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacaaaacgccattgtacgacacgcatgtcgccatgggcggcaagatggtggat
ttcggcggatgggacatgccgctgcattacggatcgcagctggaagagcacgaaaaggtg
cgcactgacgcgggcatgtttgatgtgtcccacatgacagtggtcgatatcgatggcgac
ggcgcccgcgattatctgcgttatctgctggccaacgatgtggcaaaactggatggggtg
acgggcaaggcactctataccggtatgctgaatgaaaaaggtggcgtgatcgacgatctg
atcgtctacctcaaggagtctggctatcgggtggtggtcaactgcgcgactcgggaaaag
gatctggagtggatgtccaggcaggctgaggccttcgatgtctccctgagcgagcgtccc
gagctggccatggtggccattcaaggtcccaacgcgattgacaaagtcaagcaagtgatg
ggcatcgagtgggtttccgccatcgacaatctcaaggtgttccagagcgtggcccgcggt
gactggtttgtcgcccgcaccggttataccggtgaagacggcctggagattatgttgtcc
ggtgaggatgcgcccggattttggcgcgccctggcagatgcgggtgtggcaccctgtggc
ctgggagcccgggataccctgcgcctggaagcgggaatgaacctgtacggtcacgagatg
gatgaagatacctcgccgctggtggcgaatatgggttggactatcgcctggcagccggag
gaccgcgactttatcggccggactgcgctggaggaagaaaaagcccagggtgttaaagaa
aaactggttggcctcgttttgaaagagcgcggtgtgctgcgcgccgggcaaccggtagtg
gtggacggcagtgaagagcgcggtattatcaccagcggcaccttttccccgactctgggc
tactctattgcgttggcgagggtaccggtttctgtgggagacacggcgcaagtggaaatg
cgcaagaaactggtgtccgtgaaggtggtgaaaccctgtttcgtacgcaacggcaaatcg
gtgatttga

DBGET integrated database retrieval system