KEGG   Methanosarcina thermophila CHTI-55: MSTHC_0917Help
Entry
MSTHC_0917        CDS       T03891                                 

Definition
(GenBank) Mannose-1-phosphate guanylyltransferase (GDP)
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
mthe  Methanosarcina thermophila CHTI-55
Pathway
mthe00051  Fructose and mannose metabolism
mthe00520  Amino sugar and nucleotide sugar metabolism
mthe01100  Metabolic pathways
mthe01110  Biosynthesis of secondary metabolites
mthe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mthe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MSTHC_0917
   00520 Amino sugar and nucleotide sugar metabolism
    MSTHC_0917
Enzymes [BR:mthe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     MSTHC_0917
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     MSTHC_0917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 IspD Cupin_6 Cupin_3
Motif
Other DBs
NCBI-ProteinID: AKB15235
UniProt: A0A0E3L0E1
Position
complement(1149764..1151140)
Genome map
AA seq 458 aa AA seqDB search
MTGIKSIILAGGSGTRLWPLSREMYPKQFLKFGDTSLFQETVLRCLEISNISEIFVVTNE
AQKFFVIGQIMEMGYTIPPENVLIEPEGKNTLPAIFFGMREIEKKFGRSVVGVFSSDHVL
DRTAMQTISSAEGLASDYLVTFGVVPSFPHTGYGYIKTSEICGPGYRVSEFREKPDLETA
KKYIQEGCLWNSGMFLLDTQLFFEEVKKHAPSVFACFENGKDINEIYACVDNISIDYGIM
EKSDRVAVVKLEQKWSDLGNFAAIYDELEKDPAGNVVLGCDPLLLSSDGNLVYSKCGKIV
SLIDIKDMVVVDTSDALLICPKSSSQKVKDVVTTLKDRKDERAEIGQTVYRPWGSYTVLE
ASAGHKIKNITVLPNHKLSLQLHYHRSEHWVVVKGMACVEVGGQQSFLRPGESTFIRAGE
KHRLSNPGKVPLEIIEVQLGELVDEEDIVRFDDVYGRK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgacaggtataaaatcaataattcttgcaggtggctcaggaacgcggctctggcctctt
agccgggaaatgtatccaaaacaatttttaaagtttggagatacatctctttttcaggaa
accgtcctccggtgccttgaaatttccaacatttccgagattttcgttgtaacgaatgaa
gctcagaaattttttgtaatcgggcaaattatggaaatggggtacacaattccgccagaa
aacgtcctaatcgagcctgaaggcaagaatactcttcctgcaatcttttttggaatgaga
gaaattgagaaaaaatttggacgttctgtagttggggtcttttcttcggatcatgtcctt
gacagaactgcaatgcagacgatctcttcggctgaagggcttgcttcggactatctggtt
accttcggggttgtcccttcttttcctcatactgggtatggttatatcaaaacctcagag
atctgcggaccgggttacagggtttcggaatttagggaaaagccggatctggaaaccgca
aagaaatacattcaggaaggctgcctctggaacagtggaatgttccttctcgacacacag
cttttctttgaagaagttaaaaaacacgctccttcggttttcgcctgttttgaaaacgga
aaagacattaatgagatttatgcatgtgtggacaacatttccattgactatggaataatg
gaaaaatccgacagggtcgcagttgtaaaactggaacagaaatggagtgatctcgggaat
tttgctgcaatttatgacgagcttgagaaggatcctgcaggaaatgtggtactcggatgt
gatcctctcttgctcagttccgatggaaacctcgtatattcaaagtgcggcaaaattgtt
tccctcatagatattaaggatatggtcgttgtcgataccagtgatgctctattgatctgt
cctaaatcaagcagccagaaggtaaaagatgttgtcaccacacttaaagacaggaaggat
gaaagggcagaaattgggcagaccgtctacagaccctggggttcatatactgtacttgaa
gcttctgcaggacataagattaaaaatatcacagtacttcctaaccataagttaagcctc
cagctgcattatcatcggagcgagcactgggtggttgtcaaaggtatggcttgtgtggag
gttggcgggcagcaatctttcctgagaccgggagaaagtacctttatcagagcaggagaa
aagcaccgattgtcaaacccggggaaagtccctcttgagatcattgaagtacagttaggg
gaacttgtagacgaagaggacattgtcaggtttgatgatgtatatgggaggaaatga

DBGET integrated database retrieval system