KEGG   Methanosarcina thermophila CHTI-55: MSTHC_1262Help
Entry
MSTHC_1262        CDS       T03891                                 

Definition
(GenBank) N5-methyltetrahydromethanopterin:coenzyme M methyltransferase subunit H
  KO
K00584  tetrahydromethanopterin S-methyltransferase subunit H [EC:2.1.1.86]
Organism
mthe  Methanosarcina thermophila CHTI-55
Pathway
mthe00680  Methane metabolism
mthe01100  Metabolic pathways
mthe01120  Microbial metabolism in diverse environments
mthe01200  Carbon metabolism
Module
mthe_M00357  Methanogenesis, acetate => methane
mthe_M00567  Methanogenesis, CO2 => methane
mthe_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mthe00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MSTHC_1262
Enzymes [BR:mthe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     MSTHC_1262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrH
Motif
Other DBs
NCBI-ProteinID: AKB15580
UniProt: A0A0E3NFB6
Position
complement(1572040..1572990)
Genome map
AA seq 316 aa AA seqDB search
MFKFDKKQEVFEIGGVKFGGQPGEYPTVLVSTMFYARHKIVSDEDKGIFDREAAENLWNT
QVALSDETGLPYVNQIVGETPEAIKRYIDWFVEIDDRTPFLIDSSAGNVRAAAAQHCTEI
GVADRAIHNSINASIEQEEIDALTDSDVTAAIVLAFNATDPTVKGKIDILEVGGSGQTKG
MLQVAKECGIKYPIIDVAAMPLGAGSGATIRSIPTLKARFGLPIGGGYHNMASAWDWLRK
FKKTQPDPKAIYMPSDIGTNLVAQIAGSDYLLYGPIENVNQIFPAVAMVDIMLGETAKEL
GVEIADLANHPVTKLT
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagtttgacaagaaacaggaagtttttgaaatcggtggagttaagtttggcgga
cagcctggcgaatatccaaccgtattagtcagtaccatgttctatgcaagacacaagatt
gtatctgacgaggacaagggtatttttgacagagaagccgcagaaaatctctggaacact
caggtcgcactgagcgatgaaacggggctcccctatgtaaaccagattgtaggagaaacc
cctgaagcaattaagcgttatatcgactggttcgttgagatcgatgacaggacacctttc
ctgattgactcctcagccggaaacgtgcgtgcagcagcagctcagcactgtaccgaaatt
ggtgttgcagacagggcaatccacaactcgattaacgcaagtatcgaacaggaagaaatc
gatgctctcactgacagcgatgtaacagctgcaatcgttctggctttcaacgcaactgac
ccgaccgtaaaaggaaagatagatatccttgaagtcggcggttccggacaaaccaagggt
atgctccaggtcgcaaaggaatgtggaataaagtacccaattatcgacgtcgcagccatg
cctcttggggcaggttccggtgctactatccgctcgatacccacactgaaagcaagattc
gggctgccaatcggcggtggataccacaacatggcttcggcatgggactggctccgcaaa
ttcaagaagactcagcctgatccaaaggcaatctacatgccttcagacattggtactaac
cttgtagcccagatcgcaggttcggactatctgctctatggtcctatcgagaacgtcaac
cagattttcccagctgttgcaatggtcgacatcatgctcggtgaaactgcaaaggaactt
ggcgtcgagattgcagatctggcaaaccacccggttaccaaactgacataa

DBGET integrated database retrieval system