KEGG   Mycolicibacterium thermoresistibile: 4412656_01580Help
Entry
4412656_01580     CDS       T05542                                 

Gene name
cfiB
Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
mthn  Mycolicibacterium thermoresistibile
Pathway
mthn00020  Citrate cycle (TCA cycle)
mthn00620  Pyruvate metabolism
mthn01100  Metabolic pathways
mthn01120  Microbial metabolism in diverse environments
mthn01200  Carbon metabolism
mthn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mthn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4412656_01580 (cfiB)
   00620 Pyruvate metabolism
    4412656_01580 (cfiB)
Enzymes [BR:mthn01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     4412656_01580 (cfiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Biotin_lipoyl_2 Dala_Dala_lig_C ATP-grasp RnfC_N ATP-grasp_3 HlyD_3 AstE_AspA Peptidase_M23 HlyD_D23 PYNP_C NQRA GCV_H ATP-grasp_5 PucR
Motif
Other DBs
NCBI-ProteinID: SNW17769
Position
1:1684676..1688059
Genome map
AA seq 1127 aa AA seqDB search
MISKVLVANRGEIAIRAFRAAYELGIATVAVYPYEDRNSLHRLKADESYQIGEIGHPVRA
YLSVDEIIRVARHAGADAVYPGYGFLSENPRLAAACEQAGITFIGPSAEILALTGNKSRA
VAAARAAGIPVLASSAPSSSPEELMAAADEIGFPLFVKAVSGGGGRGMRRVADRAGLAEA
IEAAGREAESAFGDPSLYLEQAVVNPRHIEVQILADTAGNVMHLYERDCSVQRRHQKVIE
LAPAPNLPDELRERICADAVAFAREVGYAYAGTVEFLVDEQGRHVFIEMNPRIQVEHTVT
EEITDVDLVGAQLRIADGQTLADLGLSQETLRTRGTALQCRITTEDPANGFRPDVGRVTG
YRSPGGAGIRLDGGTHVGAEISPHFDSMLVKLTCRGRDFATAVARARRALAEFRVRGVST
NIPFLQAVIADPDFRAGRINTSFIDERPHLLTARIPADRGTKILNYLADVTVNKPHGERP
SAVYAQDKLPSVDLQAPPPAGSKQRLEELGPDGFAAWLRDEPAVGVTDTTFRDAHQSLLA
TRVRTNGLVMVAPYVARMMPQLLSIECWGGATYDVALRFLKEDPWDRLAAIREAVPNICL
QMLLRGRNTVGYTPYPDTVTKAFVAEATAVGIDIYRIFDALNNVDSMRPAIDAVRETGTA
VAEVAMCYTGDLSDPGERLYTLDYYLRLAEQIVAAGAHVLAIKDMAGLLRPPAAATLVGA
LRSRFDLPVHVHTHDTPGGQLATYLAAWQAGASAVDGAAAPLAGTTSQPALSAIVAATAH
TEHDTGLDLSAVCDLEPYWEALRKMYAPFESGLPAPTGRVYTHEIPGGQLSNLRQQAIAL
GLGDRFEDIEAAYAGADRVLGRLVKVTPSSKVVGDLALALVGAGVSAEEFAADPSRVDIP
DSVIGFLRGELGDPPGGWPEPLRSTALAGRRPARPTVELSAEDQAVLAQPGPKRQAALNR
LLFPGPTAEFEAHRETYGDTTSLSANQFFYGLRHGEEHRVRLERGVELIIGLEAISDPDE
RGMRTVMCIINGQLRPVQVRDKSIASQIPAAEKADRANPDHIAAPFAGVVTLNISTGDRV
EAGQTIATIEAMKMEAAITAPKAGTISRIAVSETAQVEGGDLLAVLN
NT seq 3384 nt NT seq  +upstreamnt  +downstreamnt
gtgatttccaaggtgctggtcgccaatcgtggcgagattgcgatccgggctttccgcgcg
gcctacgagttgggtatcgccacggtcgcggtgtacccgtatgaggatcggaactcgctg
caccggctgaaggccgacgagtcctatcagatcggtgagatcggccatccggtccgggcg
tatctgtcggtggacgagatcatccgggtggcccggcatgccggggcggacgcggtgtat
ccgggatacgggtttctgtcggagaatccgcgcctggcggcggcgtgcgagcaggccggt
atcacgttcatcggcccgagcgcggagatcctggcactgaccggtaacaagtcgcgggcg
gtggcggcggcccgggcggccggcatcccggtgctggcgtcgtcggcgccgtcgtcgtcg
cccgaggagttgatggccgccgccgacgagatcggcttcccgttgttcgtcaaggcggtg
tccggcggcgggggccgcggtatgcgccgggtggcggaccgggccgggctggccgaggcg
atcgaggcggccggccgggaggccgagtcggctttcggcgatccgtcgttgtatctggag
caggcggtggtcaatccccgccacatcgaggtgcagatcctggccgacaccgccggcaac
gtcatgcatctgtacgagcgggactgcagtgtgcagcggcgccatcagaaggtgatcgag
ctggcgcccgccccgaacctgcccgacgagttgcgggaacggatctgcgcggacgcggtg
gccttcgcccgcgaggtcggctatgcgtatgcgggcacggtggagttcctcgtcgatgaa
cagggccgccatgtgttcatcgagatgaacccgcggattcaggtggaacacacggtgacc
gaggagatcaccgatgtggatctggtgggtgcgcagctgcggatcgccgacgggcagacc
ctggccgatctggggttgagccaggaaacgctgcggacgcgggggacggcgttgcagtgc
cgcatcaccaccgaggacccggcgaacgggttccgcccggatgtcggccgggtgaccggg
taccggtccccagggggtgcgggcatccgcctggacggcggcacccatgtgggcgccgag
atcagcccgcacttcgattcgatgctggtgaagttgacctgccggggccgggatttcgcc
accgcggtggcccgggcacggcgcgcgctggccgagttccgggtgcgcggggtgtcgacg
aacatcccgtttttgcaggcggtcatcgccgatccggatttccgggccggccggatcaac
acctcgttcatcgacgagcggccgcatctgctgaccgcgcggatccccgccgaccgcggc
accaagatcctgaactatctggccgacgtgacggtcaacaaaccgcacggggagcggccg
tcggcggtgtacgcgcaggacaagttgccgtcggtcgacctgcaggcgcccccgccggcc
ggcagcaaacagcgcctcgaggaactgggtccggacgggttcgccgcgtggctgcgcgac
gagcccgccgtcggcgtcaccgacaccacgttccgcgatgcccaccagtccttgctggcc
acccgggtgcgcaccaacgggctggtgatggtcgcaccctatgtggcccggatgatgccg
cagctgctgtcgatcgaatgctggggtggggcgacttacgatgtggcgcttcggttcctg
aaagaagacccgtgggaccggctggccgcgatccgcgaggcggtgccgaacatctgcctg
cagatgttgctgcggggccgtaacaccgtgggctacaccccgtatccggacacggtgacc
aaggcgttcgtcgccgaggccaccgcggtcggtatcgacatctaccggatcttcgacgcc
ctgaacaacgtcgactcgatgcgtccggccatcgatgcggtgcgcgaaaccggcaccgcg
gtggccgaagtggcgatgtgttacaccggcgacctgtccgaccccggtgagcggctctac
accttggactactacctgcggctggccgaacagatcgtcgcggccggcgcgcatgtgctg
gcgatcaaggatatggccggcctgttgcggccgccggcggccgccaccctggtgggcgcg
ctgcgcagccgattcgatctgccggtgcacgtgcacacccatgacacccccggtgggcag
ttggccacctatctggcggcctggcaggccggggcgtcggcggtcgacggtgccgccgcc
ccgttggccggcaccaccagccagccggcattgagcgcgatcgtggccgccaccgcgcac
accgagcacgacaccggtctggacctgtccgcggtgtgcgatctggagccctactgggag
gcgctgcgaaagatgtacgcgccgttcgaatccgggcttcccgcgcccaccggccgggtg
tacacccacgagattccgggcgggcagttgagcaatctgcgccagcaggccatcgcgctc
gggctgggcgaccggttcgaggacatcgaggccgcctacgccggtgccgaccgggtactc
ggccggctggtcaaggtcaccccgtcgagcaaggtggtcggcgatctggcgctggcgctg
gtcggcgccggtgtgagtgccgaggagttcgccgcagatccgtcacgggtggacattccc
gactcggtgatcggctttctgcgcggcgagctgggggatccgcccggtggctggccggaa
ccgttgcgcagcaccgcccttgccgggcgccgacccgccagacccaccgtggagctgtcc
gcggaggatcaggcggtgctggcccagcccggcccgaaacggcaagccgcgctgaaccgg
ctgctgttcccgggccccaccgcggaattcgaggcgcaccgcgagacctacggcgacacc
acctcgctgagcgccaaccagttcttctacgggctgcggcacggcgaggagcaccgggtc
aggctggagcggggtgtcgagctgatcatcgggctggaagccatctccgatcccgacgag
cgcggcatgcgcacggtgatgtgcatcatcaacggtcaactgcggccggttcaggtgcgc
gacaagagcatcgccagtcagataccggccgccgagaaggccgaccgcgccaacccggac
cacatcgccgcaccgttcgccggtgtggtcaccctcaacatcagcaccggcgaccgcgtc
gaagccggccagaccatcgcgaccatcgaggccatgaagatggaggcggcgatcaccgca
cccaaggccggcaccatcagccgcatcgcggtctccgaaaccgcccaggtcgagggcggt
gacctgctggcggtgctcaactga

DBGET integrated database retrieval system