KEGG   Mycolicibacterium thermoresistibile: 4412656_01682Help
Entry
4412656_01682     CDS       T05542                                 

Gene name
mqo
Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
mthn  Mycolicibacterium thermoresistibile
Pathway
mthn00020  Citrate cycle (TCA cycle)
mthn00620  Pyruvate metabolism
mthn01100  Metabolic pathways
mthn01110  Biosynthesis of secondary metabolites
mthn01120  Microbial metabolism in diverse environments
mthn01130  Biosynthesis of antibiotics
mthn01200  Carbon metabolism
Module
mthn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mthn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mthn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4412656_01682 (mqo)
   00620 Pyruvate metabolism
    4412656_01682 (mqo)
Enzymes [BR:mthn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     4412656_01682 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3 TilS
Motif
Other DBs
NCBI-ProteinID: SNW17871
Position
1:1797916..1799469
Genome map
AA seq 517 aa AA seqDB search
MSDSKVVTTDVVLVGAGIMSATLGALLRLVEPNWSITLIERLDGAAAESSDPWNNAGTGH
SALCELNYTPQRPDGSIDTTKAIHVNEQFQVSRQFWAYAVENGVLPDVRSFLNPIPHVSF
VQGAENIDYLRRRYEALVTNPLFASMEFIDDHDEFSRRLPLMAYQRDFSEPVALNWTQDG
TDVDFGSLSRQLIAYVAEHGMTTMFGHEVRDLVKQRDGGWLVKVVNRRTGARRRIKAKFV
FVGAGGGALPLLQKAGIPEVKGFGGFPVGGQFLRTNDPALTAAHKAKVYGLPPLGAPPMS
VPHLDARVINRKSWLLFGPFAGWSPKFLKHGKITDLPFSVKPNNLASMIGVGLTEMGLLK
YLIGQLLMSEADRVEALREFAPSARDSDWELDIAGQRVQVIRRKGRGGVLEFGTTVLSAA
DGSIAGLLGASPGASTAVPAMIEVMERCFSDRYQSWLPKLKEMVPSLGVELSKEPALFRE
VWAHGTKVLKLDQPASGLPSSSTEPAGTEHTPTAATG
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggattccaaagtagtcaccacagacgtcgtactggtgggcgctggcatcatgagc
gccaccctgggagcgttgctgcggctggtggagccgaactggtcgatcacgttgatcgaa
cggctcgacggcgccgctgccgagagcagcgacccgtggaacaacgcgggcaccgggcat
tcggcgctgtgtgagctgaactacaccccgcaacggccggacggttccatcgacaccacc
aaggccatccacgtcaacgagcagttccaggtctcccggcagttctgggcgtacgcggtg
gagaacggggtgctgcctgacgtgcgcagcttcctcaacccgatcccgcacgtcagcttc
gtgcagggcgccgagaacatcgactacctgcggcgccgctacgaggcgctggtgaccaac
ccgctgttcgcctcgatggagttcatcgacgatcacgacgagttcagccgacgcctgccg
ctgatggcctaccagcgtgacttctccgagccggtcgcgctgaactggacgcaggacggc
accgacgtcgacttcggctcgctgtcccgccagctgatcgcctacgtcgccgaacacggg
atgaccacgatgttcggtcatgaggtgcgcgatctggtcaagcagcgcgacggcggctgg
ctggtcaaggtggtcaaccggcgcaccggcgcgagacggcggatcaaggcgaagttcgtg
ttcgtcggcgccggcggcggggcactgccgctgctgcagaaggccgggatcccggaggtc
aagggcttcggcgggttcccggtcggcgggcagttcctgcgcaccaacgatccggcgctg
accgcggcgcacaaggccaaggtgtacggactgccgccgctcggtgcgccgccgatgtcg
gtgccgcacctcgatgcccgggtgatcaaccgcaaatcctggctgctgttcggcccgttc
gccggctggtccccgaagttcctcaaacacggcaagatcaccgatctgccgttctcggtg
aagcccaacaacctcgcatcgatgatcggggtcggcctcaccgagatggggctgctgaag
tacctgatcgggcagctgctgatgagcgaggccgaccgcgtcgaggcgttgcgcgaattc
gcgcccagcgcacgcgactccgactgggaactcgacatcgccgggcagcgggtgcaggtc
atccgccgcaagggccgcggcggtgtgctggagttcggcaccacggtgctctcggcggcc
gacgggtcgatcgccggcctgctgggcgcctcgccgggcgcctccaccgcggtgccggcg
atgatcgaagtgatggaacggtgtttctccgaccggtaccagtcctggctgcccaagctc
aaggagatggtgccgtcgctgggtgtcgagctgtccaaggagcccgcgctgttccgcgag
gtgtgggcgcacggcaccaaggtgctcaaactcgatcagccggccagcggattgccctcc
agctcaaccgagcccgccggcaccgaacacaccccgacagcggcgaccggttga

DBGET integrated database retrieval system