KEGG   Mycolicibacterium thermoresistibile: 4412656_01736Help
Entry
4412656_01736     CDS       T05542                                 

Definition
(GenBank) acyl-CoA dehydrogenase domain-containing protein
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
mthn  Mycolicibacterium thermoresistibile
Pathway
mthn00071  Fatty acid degradation
mthn00410  beta-Alanine metabolism
mthn00592  alpha-Linolenic acid metabolism
mthn00640  Propanoate metabolism
mthn01040  Biosynthesis of unsaturated fatty acids
mthn01100  Metabolic pathways
mthn01110  Biosynthesis of secondary metabolites
mthn01200  Carbon metabolism
mthn01212  Fatty acid metabolism
Module
mthn_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mthn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    4412656_01736
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4412656_01736
   00592 alpha-Linolenic acid metabolism
    4412656_01736
   01040 Biosynthesis of unsaturated fatty acids
    4412656_01736
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4412656_01736
Enzymes [BR:mthn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     4412656_01736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N
Motif
Other DBs
NCBI-ProteinID: SNW17924
Position
1:complement(1852620..1854557)
Genome map
AA seq 645 aa AA seqDB search
MTTTAEHLRNALDGRWRDVKNEMRERLSDEVFRPHFTPNTVIARTKVNEQLRIMAAAGAA
EDGFRKEHGGTGDVGAAITRIEMLAMSDLSLMVKAGVQWGLFGGAIENLGTERHHRKYVR
RIIDCDLLGCFAMTETGHGSNVQALETTATYDPATREFVIHSPTPTSRKDYIGGAAQTAR
MAAVFAQLITHEDGAPVQHGVHCLLVPLRDEDGNDLPGVTTSDNDYKGGLPGVDNGRIMF
DHVRVPRENLLNRYGDVSEDGTYTSPIESPGRRFFTMLGTLVRGRVTVGGSASAAARVAL
DIATRYALQRRQFSGPGDDDTEVLIMDYLVHQRRLFPLIAESYALQFAQNELVAKCHDLQ
SQDDPDPEEQRELEARAAGLKAVGTWHASRAIQESREACGGAGYMGENRLVGLRGDIDVF
TTFEGDNTVMLQQVAKGLLTAYADDVRSMSPVEWVRFAANTVGTRVLKRTAAQPIIQTIL
DNRQDSEEEGSLFNRGTQLQMFSDREEYMLSSVARRLQGKSKEMSEFDAYNAVQDHVLHT
ARAHIDRVILEAFVAGIDACPDEEAAHILGMVCDLYALSVIERDEAWFIKHRFLSTERAK
AVTRGINERCRTLRPYAELLVDGFGIPEQLRDAEMLHPERILQAD
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccactgccgaacatctgcgcaacgcactggacgggcgctggcgcgacgtcaag
aacgagatgcgcgagagactctcggatgaggtgttccggccgcacttcacccccaacacc
gtcatcgcccgcaccaaggtgaacgaacagttgcggatcatggccgccgccggtgcggcc
gaggacggtttccgcaaggagcacggcggcaccggggacgtgggtgcggccatcacccgg
atcgagatgctggccatgtcggatctgtcgctgatggtcaaggccggcgtgcagtggggg
ttgttcggcggtgcgatcgagaacctcggcaccgaacggcatcaccgcaagtatgtgcgc
cgcatcatcgactgcgatctgctgggctgcttcgcgatgaccgagaccggccacggcagc
aacgtgcaggcgctggagaccaccgccacctacgatccggccacccgggaattcgtcatc
cactcccccaccccgacgtcgcgcaaggactacatcggcggggccgcccagaccgcgcgg
atggcagcggttttcgcgcagctgatcacccacgaggacggtgcgccggtgcaacacggg
gtgcactgtctgctggtgccgctccgcgacgaggacggcaacgacctgccgggcgtgacg
acctccgacaacgattacaagggcgggctgcccggggtggacaacggccgcatcatgttc
gaccacgtgcgggttccccgggagaacctgttgaaccggtacggcgacgtgtccgaggac
ggcacctacacctcaccgatcgagagcccgggccgccggttcttcaccatgctgggcaca
ttggtccgcggccgggtcaccgtcggcggcagcgcgtcggcggcagcgcgggtggcgctc
gacatcgcgacccggtacgcgttgcagcgccggcagttctccggtcccggcgacgacgac
accgaggtgctgatcatggactacctggtgcaccagcgccggctgtttccgttgatcgcc
gaatcgtatgcgctgcagttcgcgcagaacgaactggtggccaaatgccacgacctgcag
agtcaggacgacccggatcccgaggagcagcgcgaactggaggcccgggcggccggcctc
aaggcggtcggcacctggcatgccagccgggcgatccaggagtcccgcgaggcgtgcggc
ggcgccgggtacatgggtgagaaccggctggtcgggctgcgcggcgacatcgacgtgttc
accacgttcgagggcgacaacaccgtgatgctgcagcaggtcgccaagggactgctcacc
gcctacgccgacgacgtccgcagtatgagcccggtggagtgggtacggttcgccgccaac
accgtcggcacccgggtgctgaaacgcaccgcggcgcaaccgatcatccagaccatcctg
gacaaccggcaggacagcgaggaggagggcagcctgttcaaccgcggcacccagcttcag
atgttctccgaccgcgaggaatacatgctgtcgtcggtggcccgccgcctgcagggcaag
agcaaggagatgagcgagttcgacgcgtacaacgccgtgcaggaccatgtgctgcacacg
gcccgggcgcacatcgaccgggtgatcctggaggcgttcgtcgccgggatcgacgcctgc
ccggacgaggaggccgcgcacatcctcggcatggtgtgcgatctgtacgcgttgtcggtg
atcgagcgcgacgaggcctggttcatcaaacaccgcttcctgtcgaccgaacgcgccaag
gcggtcacccggggtatcaacgagcgctgccggaccctgcggccgtacgccgagttactc
gtcgacggcttcggtatccccgaacagctgcgcgacgccgagatgctgcatcccgaacgg
attctgcaggcggactag

DBGET integrated database retrieval system