KEGG   Moorella thermoacetica DSM 521: MOTHE_c19970
Entry
MOTHE_c19970      CDS       T06431                                 

Gene name
ndhS1
Definition
(GenBank) nicotinate dehydrogenase small FeS subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
mtho  Moorella thermoacetica DSM 521
Pathway
mtho00230  Purine metabolism
mtho01100  Metabolic pathways
mtho01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mtho00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    MOTHE_c19970 (ndhS1)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3 Fer2_4
Other DBs
NCBI-ProteinID: AKX94780
UniProt: A0A1D7XDC0
Position
complement(1932669..1933130)
AA seq 153 aa
MLKKISFTVNDTPVTLEVDAGETLLEVLRNRLGYTGVKKGCGVGECGACTVLIDGTPVDS
CIYLAVWAEGKKIITIEGIAKNGELSRVQKAFIEEGAIQCGFCTPGYVLTATALVESGKK
YSREEIKRELAGHLCRCTGYQNILRAVEKALND
NT seq 462 nt   +upstreamnt  +downstreamnt
ttgcttaaaaaaatctccttcacggtcaatgatacaccggtaactttagaagttgacgct
ggcgagacattgctggaggtactgcgcaaccgcctggggtataccggggtgaaaaaggga
tgcggtgtgggcgaatgcggcgcctgcaccgtgcttatcgacggtactccggtggactcc
tgcatctacctggctgtttgggcggaagggaaaaagataattaccatagaaggcatagcc
aaaaacggggaactctccagggtacagaaagcctttatagaagagggcgccatccagtgc
ggcttctgcacgccaggctatgtccttaccgctacagccttggtagaaagcggtaaaaaa
tattctcgggaagaaattaagcgggaactggccggccatctctgccgctgcaccggttat
cagaatatcctcagggccgtggagaaagccttaaacgattaa

DBGET integrated database retrieval system