KEGG   Moorella thermoacetica DSM 521: MOTHE_c19990
Entry
MOTHE_c19990      CDS       T06431                                 

Gene name
xdhA
Definition
(GenBank) xanthine dehydrogenase molybdenum-binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
mtho  Moorella thermoacetica DSM 521
Pathway
mtho00230  Purine metabolism
mtho01100  Metabolic pathways
mtho01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mtho00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    MOTHE_c19990 (xdhA)
Enzymes [BR:mtho01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     MOTHE_c19990 (xdhA)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C PB1
Other DBs
NCBI-ProteinID: AKX94782
Position
complement(1934025..1936316)
AA seq 763 aa
MASTAVGKSVTRVDAVAKVTGQAKYTGDFMFRDMLVGKVLRSPYAHAIVKNIDVSQARAL
PGVEGVLTYKDVPRNKFPTAGHPYSLDPAHGDKADRTILTDKARFVGDAIAAVIARDELT
AAEALKLIKVEYEVLEPLLTPEAAMREGAPLIHEDCPGNILSASGYAIGDVDEAFKEADY
IFEDELETNIVQHCQLENHISCAYVDSDGRIVIITSTQIPHIVRRIVGQALGIPWGRIRV
IKPYVGGGFGSKQDVCTEPLAAAMTLAVGGRPVKLELSREECMIATRTRHAFKFKIKTGV
SRDGRLIGMHIKAISNTGAYASHGHSIAMAGGSKFRILYPMKALKYEPFTVYTNLPVAGA
MRGYGSPQITFAVESHLDNIASKLNIDPIEFRLKNLVKEGYVDPLNGNAVRSCGIRECIA
RGKELIKWDEKKARYKNQTGSRRRGLGMACFSYGSGTYPVGLEIGGARIVLNQDGSVQLQ
VGATEIGQGSDTVFAQMVAEVLGIPVDMVHVLSTQDTDISPFDTGAYASRQTYITGMAVA
RAAAEVKEKILDFAWGMTDIPAHALDIKDANIVYKHSGEVVMPLAEVALHTYYDTVFAKP
ITSDTSNNARVNAFVFGVTFAEVEVDLKTGRIEVLEIYNVHDSGRIINRQLAAAQVHGGV
GMGIGYALSEQLLFDEKTGQPLNNNLLDYKLPTIMDIPAIGVDFVETFEPTSPFGCKALG
EPPIIPVAPAIRNAVFDATGVAFDRLPMNPQRVFEKFKEAGLI
NT seq 2292 nt   +upstreamnt  +downstreamnt
atggcttctacagcagtggggaagagtgtcaccagggttgatgctgtggccaaagttacc
gggcaagcaaagtataccggggattttatgttcagggacatgctggtcggtaaggtctta
agaagtccctatgcccatgccatcgttaaaaacattgatgtcagccaggccagggcttta
cccggcgtggaaggggtcctgacttataaggatgtaccgcggaataaattccccactgcc
gggcatccctattccctggatccggcccacggcgataaggccgaccgtaccatcctgacc
gataaagcccgcttcgtcggtgacgccatcgcggcggtaatagccagggatgagctgacg
gccgccgaggccctgaagcttattaaggtagagtacgaggtgttagaacccctcctcacc
ccggaggcagccatgcgggagggcgcgcccctgattcatgaggattgccctggcaacatc
ctcagtgccagtggctatgccatcggcgacgtcgacgaggcttttaaagaagccgactat
atctttgaggatgaactggaaactaacattgttcagcattgccagctggaaaatcatata
tcctgcgcttatgtcgacagcgacggccgcatagtgattataacctccacccagatcccc
catattgtcaggagaatcgtcggccaggccttgggtatcccttggggcaggatccgggta
atcaagccctacgtcgggggcggctttggtagcaaacaggatgtctgcaccgaacccctg
gccgcagccatgaccctggccgtggggggaaggccggtaaaactggaactttcccgggaa
gaatgcatgattgccacccgcacccgccatgccttcaagtttaagatcaaaaccggggtt
tcccgggacggcaggttaatcgggatgcatatcaaggccatttccaataccggggcctat
gcctcccacggtcattccatcgccatggccggtggttccaaattcaggattctttatccc
atgaaggctttgaaatatgaaccatttacagtttacaccaacctgccggtggcgggagcc
atgaggggttatggatcgccccagataacctttgccgtggaaagccatctggataacatc
gccagcaaactcaatatcgatcctattgagttccgtctgaaaaacctggttaaagagggt
tatgtcgatcctttaaatggcaacgcggtgcggagttgcggcattcgcgagtgcattgcc
cggggcaaagagttgatcaagtgggacgagaaaaaagcgcggtataaaaaccaaaccggc
agcagacgccggggcctgggcatggcctgcttcagctacggttccggcacttacccggtg
gggctggaaataggaggggcgcggatcgtcctgaaccaggacggttccgtccagctacag
gttggagctacagaaataggtcagggcagcgataccgtctttgcccagatggtagccgag
gtcctgggtattccggtggatatggtccatgtcctttccacccaggatacagatatttcc
ccctttgataccggtgcctatgcttcccggcagacctatatcaccggtatggcggtggcc
agggcggccgcggaggtcaaggagaagatcctggattttgcctgggggatgaccgatatc
ccagcccatgccctggatattaaagatgccaatatcgtctataaacactcgggcgaagtg
gtcatgcccctggccgaggtggccctgcatacctattacgacaccgttttcgccaaaccg
ataacgagcgatacctccaataatgcccgggtcaacgcctttgtttttggcgttaccttt
gccgaggtggaagtagacctgaaaaccggccggatcgaggtcctggagatatataacgtc
cacgattccggcaggattatcaaccgccagctggcggcagcccaggtccacggcggcgtg
ggcatgggcataggttatgccctctccgagcaattgctctttgacgagaagaccggccaa
ccactgaataacaatctgctggattacaaactgcctacgattatggatattcccgcaatc
ggcgtagattttgtggaaacctttgaacctaccagcccctttggctgcaaggctttaggc
gagccgccgattattcctgtggccccggccattcgtaatgccgttttcgacgccacgggc
gtggcttttgacaggttgcccatgaatccccaacgggttttcgaaaagttcaaggaagcc
gggttaatatag

DBGET integrated database retrieval system