KEGG   Methanosarcina thermophila TM-1: MSTHT_2234Help
Entry
MSTHT_2234        CDS       T03892                                 

Definition
(GenBank) Pyruvate carboxyl transferase subunit A
  KO
K01959  pyruvate carboxylase subunit A [EC:6.4.1.1]
Organism
mthr  Methanosarcina thermophila TM-1
Pathway
mthr00020  Citrate cycle (TCA cycle)
mthr00620  Pyruvate metabolism
mthr00720  Carbon fixation pathways in prokaryotes
mthr01100  Metabolic pathways
mthr01120  Microbial metabolism in diverse environments
mthr01200  Carbon metabolism
mthr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mthr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MSTHT_2234
   00620 Pyruvate metabolism
    MSTHT_2234
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MSTHT_2234
Enzymes [BR:mthr01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     MSTHT_2234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C RimK ATP-grasp ATP-grasp_3 ATP-grasp_5 ATPgrasp_Ter Oxidored_nitro OAD_gamma
Motif
Other DBs
NCBI-ProteinID: AKB13992
UniProt: A0A0E3NED7
Position
2721100..2722581
Genome map
AA seq 493 aa AA seqDB search
MFKKVLVANRGEIAIRVMRACRELGISTVAVCSEADKNALFAKYADEAYLIGPAPSSQSY
LNMEAILAVAKSTGAEAIHPGYGLLSENPVFAKRCEEEGIVFIGPPSHVIAEMGSKIRAR
NLMMKAGVPVVPGTMDAVEDVDEALKIAEEIGYPVLIKASAGGGGIGMKVVHCRDELAAA
LSSTRQMAGSAFGDSSVFIEKYAEEPRHIEIQILADGYGNTIYLSDRECSIQRRHQKLIE
EAPSPIMTPELRAKMGEAAVRVAKTIGYVNAGTVEFLYSKGNFYFLEVNTRLQVEHGITE
MVTGVDIVREQLRIAWGEKLELKQEDITINGHAIECRINAEDPLNDFAPSPGKIRGYRSA
GGPGVRVDSGVHTGYTISPYYDSMISKLCVWAKTRDAAIARMERALYEYVIVGVKTNIPF
HKAVMRNPAFRRGDLTTSFIEDQKIMESVEEVVKADAEKGATLASALEAKDKKVAAITAA
VHAYVSMAQKRQR
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaaaagtactcgtcgcaaaccgcggtgagattgcgataagggttatgcgtgcc
tgccgagaactcggtatctctacagtcgcagtctgttcggaagctgacaaaaatgccctt
tttgccaagtatgctgatgaggcctacctgataggcccggctccttccagccagagctat
ctgaatatggaggctatccttgcagttgcaaaaagcacaggagctgaagcaattcatccg
ggctacggcctcctttccgaaaaccctgtctttgcaaaacgctgtgaagaagaaggaatt
gttttcatagggccccccagtcatgtgattgccgagatgggaagcaagataagggcaagg
aaccttatgatgaaggctggcgtgcctgtagtgcctggaacgatggatgcagttgaggat
gtggatgaggctctgaagatagcggaagaaattggctatcctgtcctgatcaaagcctcg
gcaggaggcggcggaattggaatgaaagtggtacattgcagggatgaacttgccgccgca
cttagctcaaccagacaaatggctggctcggcttttggggactcctcggtcttcatcgaa
aaatatgcagaagaaccaaggcacatagaaattcagattctggcagatgggtatggaaac
acaatttacctctcagatagagagtgttccatccagagaaggcatcagaagctcattgag
gaagctccttctcctatcatgacccctgaactcagggcaaagatgggagaagctgcagtc
agagtagcaaagacaattggttatgtaaacgctggcacagtggagtttctttattcaaag
ggcaacttctatttccttgaggtcaatactcgcctgcaggtcgaacacgggataaccgaa
atggtaactggtgttgacatcgtaagggaacagttaaggatagcctggggagaaaaactt
gagcttaagcaggaagatatcaccattaacgggcatgctatcgagtgcaggatcaacgcg
gaagatccgttaaatgattttgcaccttctcctggaaagatccggggatatcggtctgca
ggcggtcctggagttagggtggatagcggagtacatacaggttacacgatctctccatac
tacgactcgatgatctcgaagctttgtgtctgggcaaagacaagagatgcagcgattgcc
aggatggaacgagcgctttatgaatatgtgattgttggagtaaaaaccaatattcctttc
cacaaggcagttatgcgcaacccggctttccgcagaggtgaccttacaacgtcttttatc
gaagatcagaagattatggagtcagttgaagaggtcgtcaaagcggatgctgaaaaggga
gctactcttgcctcagctcttgaagcaaaagacaaaaaagttgcagctatcactgctgct
gtacacgcctatgtgagcatggcacaaaaaaggcagcgctga

DBGET integrated database retrieval system