KEGG   Methanosarcina thermophila TM-1: MSTHT_2390Help
Entry
MSTHT_2390        CDS       T03892                                 

Definition
(GenBank) Nicotinamide-nucleotide adenylyltransferase, NadM family
  KO
K00952  nicotinamide-nucleotide adenylyltransferase [EC:2.7.7.1]
Organism
mthr  Methanosarcina thermophila TM-1
Pathway
mthr00760  Nicotinate and nicotinamide metabolism
mthr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mthr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    MSTHT_2390
Enzymes [BR:mthr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     MSTHT_2390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like DUF5446 FAD_syn
Motif
Other DBs
NCBI-ProteinID: AKB14148
UniProt: A0A0E3NEK3
Position
2910611..2911132
Genome map
AA seq 173 aa AA seqDB search
MVRAFYIGRFQPYHFGHHAIIKQIAEEVDELVIGIGSAQKSHEPTDPFTAGERVLMLYNA
LENLPIRHYVLPIEDVRYNSIWVHHVASRTPNFQVVYSNNPLVIQLFREAGFCVKESPLY
VREKYSGTEIRRRMVAGEKWEHLVPKPIVEVIKEIDGVTRLRNVSASDSTSSL
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgagctttttatattggacgttttcaaccgtatcatttcgggcaccatgctata
attaagcagattgcggaagaagttgacgaattggtcataggcataggaagcgcccagaaa
agtcacgaacccactgatccttttacggcaggggaaagagtgttgatgctgtacaatgcg
cttgaaaatctccctatccgacactatgttctccccattgaagacgtcagatataactct
atctgggttcatcacgttgcatcccgaactccaaattttcaagtagtgtactcaaacaat
ccacttgttattcaactcttccgagaagccgggttttgcgtaaaggaatcccccctttat
gttcgggagaaatattctggcacggagatccggaggcggatggttgcaggggagaaatgg
gaacaccttgttccaaaacctattgtggaagtcataaaggaaattgatggagtaactcgc
ttaagaaatgtttctgccagtgatagcacttcttcgctatga

DBGET integrated database retrieval system