KEGG   Methanosarcina thermophila TM-1: MSTHT_2523Help
Entry
MSTHT_2523        CDS       T03892                                 

Definition
(GenBank) Coenzyme B synthesis from 2-oxoglutarate: steps 4, 7, 8, 11, and 12 (large subunit)
  KO
K16792  methanogen homoaconitase large subunit [EC:4.2.1.114]
Organism
mthr  Methanosarcina thermophila TM-1
Pathway
mthr00300  Lysine biosynthesis
mthr00680  Methane metabolism
mthr01100  Metabolic pathways
mthr01120  Microbial metabolism in diverse environments
mthr01130  Biosynthesis of antibiotics
mthr01210  2-Oxocarboxylic acid metabolism
mthr01230  Biosynthesis of amino acids
Module
mthr_M00608  2-Oxocarboxylic acid chain extension, 2-oxoglutarate => 2-oxoadipate => 2-oxopimelate => 2-oxosuberate
Brite
KEGG Orthology (KO) [BR:mthr00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MSTHT_2523
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    MSTHT_2523
Enzymes [BR:mthr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.114  methanogen homoaconitase
     MSTHT_2523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase DUF521
Motif
Other DBs
NCBI-ProteinID: AKB14281
UniProt: A0A0E3KQG5
Position
3070545..3071786
Genome map
AA seq 413 aa AA seqDB search
MGTISEKIFSRAAGTEAKANDFVLADIDYAMAHDGTSILAVNAFKEMGMKEVWDSSRIVI
PFDHIAPANNETSATLQKEIREWVKEQGIPNFYEIGEGICHQVLPENGFALPGKLVVGAD
SHSCTYGAFGAFATGVGATDMAEIFATGKLWFKVPESLRFTVEGRLGEGVYAKDLTLYLI
GKTGIDGATYKAVEFYGSSISELSVSGRMTLCNMAIEMGAKTGIVPPDEKIFNFLNNRAV
APYEPVYADHDAVYAEELTYSADDIEPQVACPHQVDNVKPVGEVEGIHVDQVFIGTCTNG
RLEDLEIAASILKGKKVAVRTVVIPASRTTLLAAIENGTMETLLKAGVTLATPGCGPCLG
AHQGVLGEGEVCISTANRNFKGRMGKGGFIYLASPATAAASALSGEITDPRKI
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
ttgggaacaattagtgagaaaatcttctcccgggcagcgggaacagaggcaaaggcaaat
gattttgtcctggcagatatcgattatgcgatggcgcatgacggcacctcgatacttgca
gttaatgctttcaaggaaatggggatgaaagaggtctgggactcctcaaggatagtaatt
cctttcgaccacattgcgcctgcaaataatgaaacgtcagcgacactacaaaaagagatc
agagaatgggtaaaggagcagggcatcccgaacttttatgagattggggaaggaatctgc
catcaggtacttcctgaaaacggattcgcactgccaggaaaactggttgtgggagccgat
tcgcattcctgcacctatggggctttcggggcttttgcaacaggcgtgggagctacggat
atggctgagattttcgccacaggcaaactctggtttaaagtgcctgagagcctcaggttc
acggttgaaggaaggcttggagaaggtgtttatgcgaaagacctgactctttatctgata
gggaaaaccggaattgacggtgccacgtataaggctgtagagttttacggatcatctatt
tccgaactatcggtttcaggcaggatgacgctctgcaacatggcaattgaaatgggagca
aaaaccgggattgttccgccggacgagaaaatcttcaatttcctgaataatcgggcagtt
gctccctatgagccggtttatgccgaccatgacgcagtctatgcagaagaattaacttac
tctgctgatgatatcgagcctcaggtcgcctgcccgcaccaggtagacaatgtaaagcct
gtgggagaggtcgaaggtatccatgtagaccaggtatttatagggacatgcacaaacggg
aggcttgaggatcttgagattgcagcctcaatccttaaggggaaaaaggttgcggtcagg
accgtagtaattcctgcatcccgcacaactctccttgcggcaattgaaaacgggacaatg
gaaactctgctcaaagcaggcgtcactcttgcgacaccaggctgcgggccctgtcttggt
gctcatcagggagtgctcggggaaggcgaggtctgtatttcaactgcaaaccggaatttc
aaaggcaggatgggaaaaggcggttttatctaccttgcgtctcctgcaaccgcagcagct
tcggcactatcaggtgaaatcacagacccaagaaaaatttaa

DBGET integrated database retrieval system