KEGG   Moorella thermoacetica DSM 2955: MOTHA_c20760
Entry
MOTHA_c20760      CDS       T06429                                 

Gene name
ndhS1
Definition
(GenBank) nicotinate dehydrogenase small FeS subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
mthz  Moorella thermoacetica DSM 2955
Pathway
mthz00230  Purine metabolism
mthz01100  Metabolic pathways
mthz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mthz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    MOTHA_c20760 (ndhS1)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3 Fer2_4
Other DBs
NCBI-ProteinID: AKX97412
UniProt: A0A1D7XDC0
Position
complement(2030743..2031204)
AA seq 153 aa
MLKKISFTVNDTPVTLEVDAGETLLEVLRNRLGYTGVKKGCGVGECGACTVLIDGTPVDS
CIYLAVWAEGKKIITIEGIAKNGELSRVQKAFIEEGAIQCGFCTPGYVLTATALVESGKK
YSREEIKRELAGHLCRCTGYQNILRAVEKALND
NT seq 462 nt   +upstreamnt  +downstreamnt
ttgcttaaaaaaatctccttcacggtcaatgatacaccggtaactttagaagttgacgct
ggcgagacattgctggaggtactgcgcaaccgcctggggtataccggggtgaaaaaggga
tgcggtgtgggcgaatgcggcgcctgcaccgtgcttatcgacggtactccggtggactcc
tgcatctacctggctgtttgggcggaagggaaaaagataattaccatagaaggcatagcc
aaaaacggggaactctccagggtacagaaagcctttatagaagagggcgccatccagtgc
ggcttctgcacgccaggctatgtccttaccgctacagccttggtagaaagcggtaaaaaa
tattctcgggaagaaattaagcgggaactggccggccatctctgccgctgcaccggttat
cagaatatcctcagggccgtggagaaagccttaaacgattaa

DBGET integrated database retrieval system