KEGG   Moorella thermoacetica DSM 2955: MOTHA_c20780
Entry
MOTHA_c20780      CDS       T06429                                 

Gene name
xdhA
Definition
(GenBank) xanthine dehydrogenase molybdenum-binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
mthz  Moorella thermoacetica DSM 2955
Pathway
mthz00230  Purine metabolism
mthz01100  Metabolic pathways
mthz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mthz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    MOTHA_c20780 (xdhA)
Enzymes [BR:mthz01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     MOTHA_c20780 (xdhA)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AKX97414
UniProt: A0A1D7XDB8
Position
complement(2032099..2034390)
AA seq 763 aa
MASTAVGKSVTRVDAVAKVTGQAKYTGDFMFRDMLVGKVLRSPYAHAIVKNIDVSQARAL
PGVEGVLTYKDVPRNKFPTAGHPYSLDPAHGDKADRTILTDKARFVGDAIAAVIARDELT
AAEALKLIKVEYEVLEPLLTPEAAMREGAPLIHEDCPGNILSASGYAIGDVDEAFKEADY
IFEDELETSIVQHCQLENHISCAYVDSDGRIVIITSTQIPHIVRRIVGQALGIPWGRIRV
IKPYVGGGFGSKQDVCTEPLAAAMTLAVGGRPVKLELSREECMIATRTRHAFKFKIKTGV
SRDGRLIGMHIKAISNTGAYASHGHSIAMAGGSKFRILYPMKALKYEPFTVYTNLPVAGA
MRGYGSPQITFAVESHLDNIASKLNIDPIEFRLKNLVKEGYVDPLNGNAVRSCGIRECIA
RGKELIKWDEKKARYKNQTGSRRRGLGMACFSYGSGTYPVGLEIGGARIVLNQDGSVQLQ
VGATEIGQGSDTVFAQMVAEVLGIPVDMVHVLSTQDTDISPFDTGAYASRQTYITGMAVA
RAAAEVKEKILDFAWGMTDIPAHALDIKDANIVYKHSGEVVMPLAEVALHTYYDTVFAKP
ITSDTSNNARVNAFVFGVTFAEVEVDLKTGRIEVLEIYNVHDSGRIINRQLAAAQVHGGV
GMGIGYALSEQLLFDEKTGQPLNNNLLDYKLPTIMDIPAIGVDFVETFEPTSPFGCKALG
EPPIIPVAPAIRNAVFDATGVAFDRLPMNPQRVFEKFKEAGLI
NT seq 2292 nt   +upstreamnt  +downstreamnt
atggcttctacagcagtggggaagagtgtcaccagggttgatgctgtggccaaagttacc
gggcaagcaaagtataccggggattttatgttcagggacatgctggtcggtaaggtctta
agaagtccctatgcccatgccatcgttaaaaacattgatgtcagccaggccagggcttta
cccggcgtggaaggggtcctgacttataaggatgtaccgcggaataaattccccactgcc
gggcatccctattccctggatccggcccacggcgataaggccgaccgtaccatcctgacc
gataaagcccgcttcgtcggtgacgccatcgcggcggtaatagccagggatgagctgacg
gccgccgaggccctgaagcttattaaggtagagtacgaggtgttagaacccctcctcacc
ccggaggcagccatgcgggagggcgcgcccctgattcatgaggattgccctggcaacatc
ctcagtgccagtggctatgccatcggcgacgtcgacgaggcttttaaagaagccgactat
atctttgaggatgaactggaaactagcattgttcagcattgccagctggaaaatcatata
tcctgcgcttatgtcgacagcgacggccgcatagtgattataacctccacccagatcccc
catattgtcaggagaatcgtcggccaggccttgggtatcccttggggcaggatccgggta
atcaagccctacgtcgggggcggctttggtagcaaacaggatgtctgcaccgaacccctg
gccgcagccatgaccctggccgtggggggaaggccggtaaaactggaactttcccgggaa
gaatgcatgattgccacccgcacccgccatgccttcaagtttaagatcaaaaccggggtt
tcccgggacggcaggttaatcgggatgcatatcaaggccatttccaataccggggcctat
gcctcccacggtcattccatcgccatggccggtggttccaaattcaggattctttatccc
atgaaggctttgaaatatgaaccatttacagtttacaccaacctgccggtggcgggagcc
atgaggggttatggatcgccccagataacctttgccgtggaaagccatctggataacatc
gccagcaaactcaatatcgatcctattgagttccgtctgaaaaacctggttaaagagggt
tatgtcgatcctttaaatggcaacgcggtgcggagttgcggcattcgcgagtgcattgcc
cggggcaaagagttgatcaagtgggacgagaaaaaagcgcggtataaaaaccaaaccggc
agcagacgccggggcctgggcatggcctgcttcagctacggttccggcacttacccggtg
gggctggaaataggaggggcgcggatcgtcctgaaccaggacggttccgtccagctacag
gttggagctacagaaataggtcagggcagcgataccgtctttgcccagatggtagccgag
gtcctgggtattccggtggatatggtccatgtcctttccacccaggatacagatatttcc
ccctttgataccggtgcctatgcttcccggcagacctatatcaccggtatggcggtggcc
agggcggccgcggaggtcaaggagaagatcctggattttgcctgggggatgaccgatatc
ccagcccatgccctggatattaaagatgccaatatcgtctataaacactcgggcgaagtg
gtcatgcccctggccgaggtggccctgcacacctattacgacaccgttttcgccaaaccg
ataacgagcgatacctccaataatgcccgggtcaacgcctttgtttttggcgttaccttt
gccgaggtggaagtagacctgaaaaccggccggatcgaggtcctggagatatataacgtc
cacgattccggcaggattatcaaccgccagctggcggcagcccaggtccacggcggcgtg
ggcatgggcataggttatgccctctccgagcaattgctctttgacgagaagaccggccaa
ccactgaataacaatctgctggattacaaactgcctacgattatggatattcccgcaatc
ggcgtagattttgtggaaacctttgaacctaccagcccctttggctgcaaggctttaggc
gagccgccgattattcctgtggccccggccattcgtaatgccgttttcgacgccacgggc
gtggcttttgacaggttgcccatgaatccccaacgggttttcgaaaagttcaaggaagcc
gggttaatatag

DBGET integrated database retrieval system