KEGG   Mycobacterium tuberculosis RGTB423: MRGA423_15080Help
Entry
MRGA423_15080     CDS       T01994                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K22306  glucosyl-3-phosphoglycerate phosphatase [EC:3.1.3.85]
Organism
mti  Mycobacterium tuberculosis RGTB423
Brite
KEGG Orthology (KO) [BR:mti00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MRGA423_15080
Enzymes [BR:mti01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.85  glucosyl-3-phosphoglycerate phosphatase
     MRGA423_15080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 PALP
Motif
Other DBs
NCBI-ProteinID: AFE13613
Structure
PDB: 

Position
complement(2716924..2717595)
Genome map
AA seq 223 aa AA seqDB search
MRARRLVMLRHGQTDYNVGSRMQGQLDTELSELGRTQAVAAAEVLGKRQPLLIVSSDLRR
AYDTAVKLGERTGLVVRVDTRLRETHLGDWQGLTHAQIDADAPGARLAWREDATWAPHGG
ESRVDVAARSRPLVAELVASEPEWGGADEPDRPVVLVAHGGLIAALSAALLKLPVANWPA
LGGMGNASWTQLSGHWAPGSDFESIRWRLDVWNASAQVSSDVL
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgagagcgcggcgactggtgatgctgcggcatggacaaacggactacaacgtcggtagc
cggatgcagggccagctggacactgagttgagcgaacttggccgcacccaagcggtcgcg
gccgccgaggtgctgggcaagcggcagccgctactgatcgtatcgtcggacctgcgccgc
gcatatgacacggcggtcaagctgggcgagcgcaccggccttgtggtccgggtcgacacc
cgattgcgggaaactcaccttggcgattggcagggcttaacccacgctcagatcgacgct
gatgccccgggcgcccggttggcctggcgcgaggatgcgacctgggcgccgcacggcggg
gaaagcagggttgacgtggctgcccgaagtcggccgttggttgccgagttggttgccagc
gaaccggaatggggtggcgctgacgagccggatcgcccggtggtgctggtagcccatggg
ggtctgatcgccgcgttgtcggcggcgctgctgaagttgccggtggccaactggccggct
ttgggcggcatgggcaatgccagttggactcagctgagtggccattgggccccgggctcc
gacttcgagagcatccggtggcgccttgatgtgtggaatgcttcggcgcaggtctccagc
gatgtcctctag

DBGET integrated database retrieval system