KEGG   Massilia oculi: DIR46_01395Help
Entry
DIR46_01395       CDS       T05448                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
mtim  Massilia oculi
Pathway
mtim00620  Pyruvate metabolism
mtim00630  Glyoxylate and dicarboxylate metabolism
mtim01100  Metabolic pathways
mtim01110  Biosynthesis of secondary metabolites
mtim01120  Microbial metabolism in diverse environments
mtim01200  Carbon metabolism
Module
mtim_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mtim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DIR46_01395
   00630 Glyoxylate and dicarboxylate metabolism
    DIR46_01395
Enzymes [BR:mtim01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     DIR46_01395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AWL03237
UniProt: A0A2S2DD20
Position
complement(318106..319695)
Genome map
AA seq 529 aa AA seqDB search
MSLTIPAGMQITGEIKPGYENILVPEALALVAQLARAFAPRRQELLAARAERARRLDAGE
RPDFLPQTAHIRDGDWRIAPIPPALACRRVEITGPVERKMVINALNSGADSYMTDFEDSN
TPNWDNQIQGQVNLFDAVRKTISLEQNGKSYQLGDKVATLIVRPRGWHLDEKHVLVDGQR
VSGGIVDFALFMFHNAKELLVRGAGPYFYLPKLESHLEARLWNDVFVMTQDALGLPQGTI
KATVLIETILAAFEMDEILYELREHSAGLNAGRWDYIFSCIKKFKLDRDFCLADRAKVTM
TAPFMRAYALLLLKTCHRRGAPAIGGMSALIPIKNDPEKNEIAMGGVRTDKARDATDGYD
GGWVAHPGLVGLAMEEFTKVLGDKPNQFEKQRPDVEVTAAQLLDFQPETPITEAGLRYNI
NVGIHYLGAWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGVLEDGRKVTADMVRE
MIPEELEKVKVVAADGTHASYERAAVIFEEMSTSDDFAEFLTLPLYEEI
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtccctcaccatccctgccggcatgcagatcacgggcgagatcaagcccggctacgag
aacatcctggtcccggaggcgctcgcgctcgtggcgcaactggcgcgtgccttcgccccg
cggcgccaggaattgctggccgcgcgcgcagagcgggcgcggcgcctggacgccggcgaa
cgcccggacttcctgccccagaccgcccacatccgcgacggcgactggcggatcgcgccg
atcccgccggcgctggcctgccggcgcgtggaaatcaccggtccggtcgagcgcaagatg
gtcatcaacgcgctcaattcgggcgccgacagctatatgaccgacttcgaggattcgaat
acgccgaactgggacaaccagatccagggccaggtcaatctgttcgatgcggtccgcaaa
accatttcgctggagcagaacggcaagtcctaccagttgggtgacaaggtggcgaccctg
atcgtgcgcccgcgcggctggcacctggacgaaaaacacgtgctggtcgacggccagcgc
gtctcgggcggcatcgtcgatttcgcgctgttcatgttccataacgccaaggaattgctg
gtgcgcggcgccggcccctatttctacctgccgaagctggaatcgcatctggaagcgcgc
ctgtggaacgacgtgttcgtgatgacccaggacgcgctgggcctgccgcagggcacgatc
aaggccacggtgctgatcgagaccattctcgccgccttcgagatggacgagatcctgtac
gagctgcgcgagcacagcgctggcctgaacgccggccgctgggactacatcttctcgtgc
atcaagaagttcaagctcgaccgcgacttctgcctggccgaccgcgccaaggtgacgatg
acggcgccgttcatgcgcgcctatgcattgctgctgctcaagacctgtcaccggcgcggc
gcgccggccattggcggcatgtcggccctcattccgatcaagaacgatccagagaaaaac
gagatcgcgatgggcggcgtgcgcaccgacaaggcgcgcgatgccacggacggctatgac
ggcggctgggtcgcgcaccccggcctggtcgggctggcgatggaagagttcaccaaggtg
ctgggcgacaagccgaaccagttcgagaagcagcgccccgacgtcgaggtgacggccgcg
caattgcttgacttccagcccgagacgccgatcaccgaggccggcctgcgctacaacatc
aatgtcggcattcactacctcggcgcctggctggccgggaatggctgcgtgccgatccat
aacctgatggaagacgcggcgacagccgagatcagccgctcgcaggtatggcagtggatc
cgctcgccgaagggtgtgctggaggacggccgcaaggtcacggcggacatggttcgggag
atgattcccgaggagctggaaaaagtgaaggtggtggcggcggacgggacgcatgcgagc
tacgaacgcgccgccgtcatcttcgaggagatgtcgacgtcggatgacttcgccgaattc
ctgaccttgccgttgtacgaggagatctga

DBGET integrated database retrieval system