KEGG   Massilia oculi: DIR46_01515Help
Entry
DIR46_01515       CDS       T05448                                 

Definition
(GenBank) diacylglycerol kinase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
mtim  Massilia oculi
Pathway
mtim00670  One carbon pool by folate
mtim00790  Folate biosynthesis
mtim01100  Metabolic pathways
Module
mtim_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mtim00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DIR46_01515
   00670 One carbon pool by folate
    DIR46_01515
Enzymes [BR:mtim01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     DIR46_01515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AWL03258
UniProt: A0A2S2DD46
Position
348588..349091
Genome map
AA seq 167 aa AA seqDB search
MRDAANLTLVVAIDAKGGIGIDNKMPWHLPEDFAHFKRVTLGKPVIMGRKTFDSIGRVLP
GRRNIVITRNADWAHEGAERAASLEAAIAMLGGAPASIIGGAQVFAQSMDVADAMIVTHI
DRIFDCDTFFPPIDAAVWRETAREPHHSEANGFDYAFVTYARREAIQ
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgagggacgccgccaacctgaccctggtggtcgccatcgacgccaagggcggcatcggc
atcgacaacaagatgccctggcacctgcccgaggacttcgcccacttcaagcgcgtcacg
ctcggcaagccggtgatcatgggccgcaagaccttcgactcgatcggccgcgtcctgccc
ggacgccgcaacatcgtcatcacccgcaacgccgactgggcgcacgaaggcgccgaacgc
gcggcgtcgctggaagcggccatcgccatgctcggtggcgcaccggccagcatcatcggc
ggcgcccaggtcttcgcccagtccatggacgtggccgacgccatgatcgtgacccacatc
gaccgcatcttcgactgcgacaccttcttcccgccgatcgacgcggccgtgtggcgcgaa
accgcgcgcgagccccaccacagcgaagccaatggcttcgactacgccttcgtgacgtat
gcgcggcgcgaggcgatccagtga

DBGET integrated database retrieval system