KEGG   Massilia oculi: DIR46_13530Help
Entry
DIR46_13530       CDS       T05448                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mtim  Massilia oculi
Pathway
mtim00480  Glutathione metabolism
mtim00590  Arachidonic acid metabolism
mtim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtim00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    DIR46_13530
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DIR46_13530
Enzymes [BR:mtim01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     DIR46_13530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin DUF4174
Motif
Other DBs
NCBI-ProteinID: AWL05352
UniProt: A0A2S2DJ15
Position
complement(2953141..2953725)
Genome map
AA seq 194 aa AA seqDB search
MIKTIVLLLAATAAVSVTQPARAQAAPAAALTKSPAACPAVLKHSFKRLQDEAPQDLCQY
AGKVVLVVNTASYCGFTKQYEGLEKIYAKYGGRGLVILGFPSNDFGQQEPGSAKEIADLC
FNTYGVKFPMFAKSSVKGPQANPLHAQLIKATGQEPKWNFTKYLIGRDGKVLDYFPSKVT
PEDPQLTGKIEAAL
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaccatcgtcctgctgctcgccgccacggccgctgtcagcgtcacccagccg
gcacgcgcgcaggccgcgccggccgccgcgctgaccaagagcccggccgcctgcccggcc
gtcctgaagcacagcttcaagcgcctgcaggacgaggcgccgcaagacctctgccagtac
gccggcaaggtggtgctggtggtgaacacggccagctactgcggcttcaccaagcagtac
gaaggtctcgagaaaatctacgccaagtacggcggccgcggcctcgtgatcctgggcttc
ccgtcgaacgacttcggccagcaggaaccgggcagcgccaaggaaatcgccgacctgtgc
ttcaacacctatggcgtcaagttcccgatgttcgccaagagctcggtcaagggcccgcaa
gccaatccgctgcacgcgcaactgatcaaggccaccggccaggaaccgaagtggaatttc
accaaatacctgatcggccgtgacggcaaggtgctcgactacttcccgagcaaggtcacg
ccggaagatcctcagctgaccgggaagatcgaagcggcgctgtaa

DBGET integrated database retrieval system