KEGG   Massilia oculi: DIR46_20510Help
Entry
DIR46_20510       CDS       T05448                                 

Definition
(GenBank) anion permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mtim  Massilia oculi
Brite
KEGG Orthology (KO) [BR:mtim00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    DIR46_20510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AWL06583
UniProt: A0A2S2DMG5
Position
4549096..4550106
Genome map
AA seq 336 aa AA seqDB search
METLHISIYVLGMLVVLALIFDFMNGFHDSANSIATVVSTGVLKPQHAVAMAAFFNFIAI
FVVNMKVAQTIGKGTIDPQIVDHYVIFGALVGAISWNLITWYYGIPSSSSHALIGGLVGA
AVAKAGTGSLISGGLLKTVAFIVVAPLLGFALGSIIMLIVAWVFVKATPRKVDGLFRKLQ
LLSAAAYSLGHGGNDAQKTMGIIWMLLIAAGYVSANDAHPPAWVIISCYAAIAFGTLFGG
WRIVKTMGQKITKLKPVGGFCAETGGAMTLLMSSAFGIPVSTTHTITGAIVGVGAAQKAS
AVRWGVAGNIVWAWVFTIPASAFIAAVAWWVGTLIL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggaaactctacatatcagcatttacgtgctgggcatgctggtcgtcctcgcgctgatc
ttcgacttcatgaacggcttccacgactcggcgaactcgatcgccaccgtcgtgtcgacc
ggcgtcctgaagccgcagcacgcggtggcgatggccgccttcttcaacttcatcgcgatc
ttcgtggtcaacatgaaggtggcccagaccatcggcaaggggaccatcgacccgcagatc
gtcgaccactacgtcatcttcggcgcgctggtgggggcgatctcctggaacctgatcacc
tggtactacggcatcccgtcctcgtcctcgcacgccctgatcggcggcctggtgggcgcg
gcggtggccaaggccggcaccggctccctgatctccggcggcttgctcaagaccgtcgcc
ttcatcgtggtggcgccgctgctgggcttcgcgctggggtcgatcatcatgctgatcgtg
gcctgggtgttcgtcaaggcgacgccgcgcaaggtcgacgggctgttccgcaagctgcag
ctgctgtcggccgcagcctattcgctgggccacggcggcaacgatgcgcagaaaaccatg
ggcatcatctggatgctcctgatcgcggcaggctacgtcagcgccaacgacgcgcatcca
ccggcgtgggtcatcatctcgtgctacgccgcgatcgccttcggtacgctgttcggcggc
tggcgcatcgtcaagaccatgggccagaagatcaccaagctcaagcccgtgggcggcttc
tgcgccgagaccggcggcgccatgaccctgctgatgtcgagcgcgttcggcatcccggtg
tcgaccacccacaccatcaccggcgccatcgtcggcgtgggcgccgcgcaaaaggcctcg
gccgtgcgctggggcgtggccggcaacatcgtgtgggcgtgggtcttcaccatcccggcg
tcggcgttcatcgcggcggtggcatggtgggttgggaccctgatcctgtaa

DBGET integrated database retrieval system