KEGG   Massilia oculi: DIR46_25260Help
Entry
DIR46_25260       CDS       T05448                                 

Definition
(GenBank) NAD-dependent dehydratase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
mtim  Massilia oculi
Pathway
mtim00053  Ascorbate and aldarate metabolism
mtim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    DIR46_25260
Enzymes [BR:mtim01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     DIR46_25260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_10 NAD_binding_4 RmlD_sub_bind NmrA Polysacc_synt_2 adh_short
Motif
Other DBs
NCBI-ProteinID: AWL07411
UniProt: A0A2S2DQ13
Position
5648783..5649616
Genome map
AA seq 277 aa AA seqDB search
MTEAVGSTKKIGKPFKRILLTGAAGGLGKVLRDRIKPWAEVVRLSDVADMGEAREGEEIV
QCDLADKEAVIKLLEGVDAVLHFGGISTEKPFEPIMQANILGVANLYEALHKAGTRRVVF
ASSNHAIGYHRTTEVLDANSPTRPDSYYGLSKVFGEQMARYYFDRFGIETVCIRIGSSFP
EPANKRMMSTFLSYDDLTELLRCSLFAPRVGHTIVYGQSDNDSTWWDNRLASHLGYKPKD
GSSKFAHLFPDTSEFPAQDDVTTMYQGGKFLLDGPQY
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagcagttggcagtacgaagaagattggcaagccgttcaagcgcatcctgctg
accggcgccgccggcggcctgggcaaggtgctgcgcgaccgcatcaagccatgggccgag
gtggtgcgcctgtcggacgtggcggacatgggcgaggcgcgcgagggcgaagagatcgtc
cagtgcgacctggccgacaaggaggcggtgatcaagctcctggaaggcgtggacgcggtg
ctgcacttcggcggcatttcgacggaaaagccgttcgaaccgatcatgcaggccaatatc
ctgggcgttgccaacctgtacgaggcgctgcacaaggccggcacccggcgcgtggtcttc
gccagctccaaccacgccatcggctaccaccgcaccaccgaggtgctcgatgcgaactcg
ccgacccgcccggacagctactacggcctgtcgaaggtgttcggcgaacagatggcgcgc
tactacttcgaccgcttcggcatcgagaccgtctgcatccgcatcggctcgagcttcccg
gagccggccaacaagcgcatgatgagcaccttcctctcctacgacgacctgaccgagctg
ctgcgctgctcgctgttcgcgccgcgcgtcggccacaccatcgtgtacggccagtcggac
aacgacagcacctggtgggacaaccgcctggcatcgcacctcggctacaagccaaaggac
ggctcgagcaagttcgcccacctgttcccggatacctccgagttcccggcccaggacgac
gtgaccacgatgtaccagggcgggaagttcctgctcgacggtccgcaatactga

DBGET integrated database retrieval system