KEGG   Mycobacterium tuberculosis Beijing/NITR203: J112_07130Help
Entry
J112_07130        CDS       T02616                                 

Definition
(GenBank) acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtj  Mycobacterium tuberculosis Beijing/NITR203
Pathway
mtj00071  Fatty acid degradation
mtj00072  Synthesis and degradation of ketone bodies
mtj00280  Valine, leucine and isoleucine degradation
mtj00310  Lysine degradation
mtj00362  Benzoate degradation
mtj00380  Tryptophan metabolism
mtj00620  Pyruvate metabolism
mtj00630  Glyoxylate and dicarboxylate metabolism
mtj00640  Propanoate metabolism
mtj00650  Butanoate metabolism
mtj00900  Terpenoid backbone biosynthesis
mtj01100  Metabolic pathways
mtj01110  Biosynthesis of secondary metabolites
mtj01120  Microbial metabolism in diverse environments
mtj01130  Biosynthesis of antibiotics
mtj01200  Carbon metabolism
mtj01212  Fatty acid metabolism
mtj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mtj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    J112_07130
   00630 Glyoxylate and dicarboxylate metabolism
    J112_07130
   00640 Propanoate metabolism
    J112_07130
   00650 Butanoate metabolism
    J112_07130
  09103 Lipid metabolism
   00071 Fatty acid degradation
    J112_07130
   00072 Synthesis and degradation of ketone bodies
    J112_07130
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    J112_07130
   00310 Lysine degradation
    J112_07130
   00380 Tryptophan metabolism
    J112_07130
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    J112_07130
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    J112_07130
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    J112_07130
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtj04147]
    J112_07130
Enzymes [BR:mtj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     J112_07130
Exosome [BR:mtj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   J112_07130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGJ67375
Position
1485732..1486901
Genome map
AA seq 389 aa AA seqDB search
MIVAGARTPIGKLMGSLKDFSASELGAIAIKGALEKANVPASLVEYVIMGQVLTAGAGQM
PARQAAVAGGIGWDVPALTINKMCLSGIDAIALADQLIRAREFDVVVAGGQESMTKAPHL
LMNSRSGYKYGDVTVLDHMAYDGLHDVFTDQPMGALTEQRNDVDMFTRSEQDEYAAASHQ
KAAAAWKDGVFADEVIPVNIPQRTGDPLQFTEDEGIRANTTAAALAGLKPAFRGDGTITA
GSASQISDGAAAVVVMNQEKAQELGLTWLAEIGAHGVVAGPDSTLQSQPANAINKALDRE
GISVDQLDVVEINEAFAAVALASIRELGLNPQIVNVNGGAIAVGHPLGMSGTRITLHAAL
QLARRGSGVGVAALCGAGGQGDALILRAG
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgattgttgctggcgcgcgtacacccatcggcaagttgatgggctccctgaaggatttc
agcgccagcgagctgggtgccatcgccattaagggcgccctggagaaggccaacgtgccg
gcgtccttggtcgagtacgtgatcatgggccaggtgttgaccgcgggtgccgggcaaatg
cccgcacggcaggcggcagtggcgggcggcatcggttgggatgtccctgcgctgacgatc
aacaagatgtgcctgtccggcatcgacgcaatcgcgctggctgatcaactcattcgggcc
agagagttcgacgtggtggtggccggcggtcaggagtcgatgacgaaggcgccccacctg
ttgatgaatagccggtcgggttacaagtacggcgacgttacggttttggaccacatggcc
tacgacggtctgcacgacgtgttcaccgatcagccgatgggcgcgctcaccgagcaacgc
aacgacgtcgacatgttcacccgctccgaacaggacgagtacgcggctgcgtcccaccaa
aaggcggccgcggcatggaaggacggcgtattcgccgacgaggtgatcccggtgaacatc
ccgcagcgcacgggcgatccactgcagttcaccgaggacgaggggatccgcgccaacacc
accgccgccgcgctggccggtctgaagccggcgttccgtggcgacggcaccatcaccgcc
gggtcggcgtcacagatctccgacggtgcggccgcggtggtggtcatgaaccaggaaaag
gcccaggaactggggctgacctggctagccgagatcggcgcccacggtgtggtggccggg
ccggattccacactgcaatcgcagccggccaacgcgatcaacaaggcgctggatcgcgag
ggcatctcggtggaccagctcgacgtggtggagatcaacgaggcgttcgctgcggtggca
ttggcctcgatacgcgaactcgggctgaacccccagatcgtcaacgtcaacggtggtgcg
attgccgtcgggcatcccctcggcatgtcagggacgcgaatcacgctacatgcggcgctg
cagttggcacgccggggatcgggcgtcggggttgccgcattgtgcggggctggcgggcag
ggcgacgcactgatattgcgggccggatag

DBGET integrated database retrieval system