KEGG   Mycobacterium tuberculosis Beijing/NITR203: J112_13105Help
Entry
J112_13105        CDS       T02616                                 

Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
mtj  Mycobacterium tuberculosis Beijing/NITR203
Pathway
mtj00330  Arginine and proline metabolism
mtj00332  Carbapenem biosynthesis
mtj01100  Metabolic pathways
mtj01130  Biosynthesis of antibiotics
mtj01230  Biosynthesis of amino acids
Module
mtj_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mtj00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    J112_13105
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    J112_13105
Enzymes [BR:mtj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     J112_13105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AGJ68534
Position
complement(2736868..2737725)
Genome map
AA seq 285 aa AA seqDB search
MNSWSAAFARYGRTVGQVLLTAHDISMRVQHTNAQRTLDRLRALHAVAIVNENDTVATNE
IRFGDNDRLSALVAHLVGADALVLLSDIDGLYDCDPRKTADATFIPEVSGPADLDGVVAG
RSSHLGTGGMASKVSAALLAADAGVPVLLAPAADAATALADASVGTVFAARPARLSARRF
WVRYAAEATGALTLDAGAVRAVVRQRRSLLAAGITAVSGRFCGGDVVELRAPDAAMVARG
VVAYDASELATMVGRSTSELPGELRRPVVHADDLVAVSAKQAKQV
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgaactcgtggagcgcggcgttcgcccgctacggccgcacggtgggccaggtgctgctg
accgcgcacgacatttcgatgcgggtgcagcacaccaacgcccaacgcacgctggatcgg
ctgcgcgcgttgcacgcggtggcgattgtcaacgagaacgacaccgtggccaccaacgag
atccggttcggtgacaacgatcggctgtctgcactggtggcgcacctggtcggcgccgac
gctttggtgctgctgtcggacatcgacggcctctacgactgcgacccgcgcaaaaccgcg
gacgcgacgttcattccggaggtgtccgggccggcggatctggacggtgtggtcgccggc
cgcagtagccacctgggtactggcggcatggcgtccaaggtgtcggcggcgctgttggcc
gccgacgccggggtgccggtactgctggcccccgcggccgacgccgcgaccgcgctcgcc
gacgcgtcggtgggcacggtgtttgcggcccggcccgcgcgtctgtcggcccggcggttc
tgggtgcgttatgccgccgaagcaaccggcgcactgactctcgacgccggtgcggtgcgc
gctgtggtgcgacaacgccggtcactgctggcggcgggtatcaccgcggtgtccggccgg
ttttgcggcggcgatgtggtcgaactgcgtgcacccgacgcggccatggtagcccgcggg
gtggttgcctacgacgcgtccgagctggccaccatggtgggccggtccacctctgagcta
cccggcgagctgcgccgcccggtggtgcacgccgacgatctggtcgcggtgtcggcgaag
caagctaagcaagtttag

DBGET integrated database retrieval system