KEGG   Mycobacterium tuberculosis Beijing/NITR203: J112_18965Help
Entry
J112_18965        CDS       T02616                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtj  Mycobacterium tuberculosis Beijing/NITR203
Pathway
mtj00071  Fatty acid degradation
mtj00072  Synthesis and degradation of ketone bodies
mtj00280  Valine, leucine and isoleucine degradation
mtj00310  Lysine degradation
mtj00362  Benzoate degradation
mtj00380  Tryptophan metabolism
mtj00620  Pyruvate metabolism
mtj00630  Glyoxylate and dicarboxylate metabolism
mtj00640  Propanoate metabolism
mtj00650  Butanoate metabolism
mtj00900  Terpenoid backbone biosynthesis
mtj01100  Metabolic pathways
mtj01110  Biosynthesis of secondary metabolites
mtj01120  Microbial metabolism in diverse environments
mtj01130  Biosynthesis of antibiotics
mtj01200  Carbon metabolism
mtj01212  Fatty acid metabolism
mtj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mtj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    J112_18965
   00630 Glyoxylate and dicarboxylate metabolism
    J112_18965
   00640 Propanoate metabolism
    J112_18965
   00650 Butanoate metabolism
    J112_18965
  09103 Lipid metabolism
   00071 Fatty acid degradation
    J112_18965
   00072 Synthesis and degradation of ketone bodies
    J112_18965
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    J112_18965
   00310 Lysine degradation
    J112_18965
   00380 Tryptophan metabolism
    J112_18965
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    J112_18965
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    J112_18965
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    J112_18965
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtj04147]
    J112_18965
Enzymes [BR:mtj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     J112_18965
Exosome [BR:mtj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   J112_18965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Peptidase_M22
Motif
Other DBs
NCBI-ProteinID: AGJ69671
Position
3959129..3960313
Genome map
AA seq 394 aa AA seqDB search
MAGKLAAVLGTGQTKYVAKRQDVSMNGLVREAIDRALADSGSTFDDIDAVVVGKAPDFFE
GVMMPELLMADAMGATGKPLIRVHTAGSVGGSTGVVAASLVQSGKYRRVLALAWEKQSES
NAMWALSIPVPFTKPVGAGAGGYFAPHVRAYIRRSGAPAHIGAMVAVKDRLNGSRNPLAH
LQQPDITLEKVMASQMLWDPIRFDETCPSSDGACAVVVGDEEIADARLAQGHPVAWIHGT
ALRTEPLAFAGRDQVNPQAGRDAAAALWKAAGITSPIDEIDAAEIYVPFSWFEPMWLENL
GFAREGEGWKLTEAGETAIGGRLPVNPSGGVLSANPIGASGLIRFAEAAIQVMGKAEARQ
VPGARKALGHAYGGGSQYFSMWVVGCEKPKQAAA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggccggaaagctggccgccgtactcggcaccgggcagaccaagtatgtcgccaagcgc
caagacgtttcgatgaacggtctggtgcgggaggccatcgaccgagcgctggcggattcc
ggttccaccttcgacgacatcgacgccgtcgtggtcggcaaggcgcccgacttcttcgaa
ggggtgatgatgccggagctactcatggccgacgccatgggcgcgaccggcaagccgctg
atccgggtacacaccgccggttcggttggcggatccaccggggtagtggctgccagcctg
gtgcaatccggcaaataccgccgggtcctggcattagcctgggaaaagcagtcggaatcc
aatgccatgtgggcgttgtcgattcctgtgccgttcaccaaaccggtcggtgccggtgcg
gggggatacttcgccccgcatgtccgggcctatatccgccgctcgggcgcaccggcacac
atcggtgctatggttgcggtcaaggaccggctcaacggcagccgcaacccgttggcacat
ctgcagcagcccgacatcaccctggagaaggtgatggcatctcagatgctctgggatcca
atacgtttcgatgagacgtgcccgtcgtcagacggtgcgtgcgcggttgtcgtcggcgac
gaggagatcgccgacgcgcgactggcgcaagggcatccggtggcctggattcatggcacc
gcattacgcaccgagccgctggctttcgccgggcgcgaccaggtcaacccgcaggccggc
cgcgacgcggcggcggcgctgtggaaggccgcgggcatcaccagccccatcgacgaaatc
gacgccgccgaaatttacgtcccgttctcctggttcgagccgatgtggttggagaatctg
ggatttgcccgcgagggcgagggctggaagctcaccgaggccggcgagactgcgatcggc
ggtcgactaccggtgaacccttccggcggcgtgctgtccgccaatccgatcggcgcatcg
ggcctgatccgcttcgccgaggccgcgatccaagtcatgggcaaggcggaggcgcgtcaa
gttccgggtgcgcgaaaggccttggggcacgcttacggtggcggctcgcagtacttctct
atgtgggtggtcggctgcgagaaacccaaacaggcagccgcataa

DBGET integrated database retrieval system