KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_00724Help
Entry
TBSG_00724        CDS       T01690                                 

Definition
(GenBank) 50S ribosomal protein L22 rplV
  KO
K02890  large subunit ribosomal protein L22
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
mtk03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mtk00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    TBSG_00724
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mtk03011]
    TBSG_00724
Ribosome [BR:mtk03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    TBSG_00724
  Bacteria
    TBSG_00724
  Archaea
    TBSG_00724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AEB02853
Structure
PDB: 

Position
804693..805286
Genome map
AA seq 197 aa AA seqDB search
MTAATKATEYPSAVAKARFVRVSPRKARRVIDLVRGRSVSDALDILRWAPQAASGPVAKV
IASAAANAQNNGGLDPATLVVATVYADQGPTAKRIRPRAQGRAFRIRRRTSHITVVVESR
PAKDQRSAKSSRARRTEASKAASKVGATAPAKKAAAKAPAKKAPASSGVKKTPAKKAPAK
KAPAKASETSAAKGGSD
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgactgcggctactaaggctaccgagtatccctcggcggtcgccaaggcccgatttgtg
cgggtgtcgccaagaaaggcgcgccgggtgatcgatctggtgcgtggcaggtcggtgtca
gacgcgctcgacatcctgcgctgggcgccgcaggccgccagcggtccggtggccaaagtg
atcgccagtgcggcggccaacgcgcaaaacaacggcgggctggacccggcaaccttggtg
gtggccaccgtgtacgccgaccagggaccgaccgccaagcgcatccgtccgcgcgcccag
ggccgcgcgttccgcatccgccggcgcactagccacatcacggtggtggtggaaagccgg
ccggccaaagatcaacggtcggcgaaatcgtcgcgggcccgccgcaccgaggccagcaag
gccgccagcaaggtcggggctacggcgccggccaagaaagcggccgccaaagcgcccgcc
aagaaggcacccgccagttccggcgttaagaagacacccgcaaagaaagcgcccgccaag
aaggcgcccgccaaggcttctgagacttctgcagcgaagggaggctcagactag

DBGET integrated database retrieval system