KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_00862Help
Entry
TBSG_00862        CDS       T01690                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase moaB1
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
mtk00790  Folate biosynthesis
mtk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TBSG_00862
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtk04147]
    TBSG_00862
Enzymes [BR:mtk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     TBSG_00862
Exosome [BR:mtk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TBSG_00862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AEB02991
Position
complement(934604..934999)
Genome map
AA seq 131 aa AA seqDB search
MTVSTPEQHEQRASHDASEGKHNVCQGRLAALADAAVSEKLGALPGWQLLDMRLSRAFQC
TNFDQSIDFMNRVASIANDINHHPDIAVLDKRSVRVTAWTRKLGYLTDIDFDLAASVEAM
YATEFADRPAR
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgacggtcagcacccctgagcaacacgagcaacgagcatcccacgatgcatccgaggga
aagcacaacgtatgtcaggggaggctggccgcacttgccgacgcggccgtgtcagagaaa
ctcggagcactacctggctggcagcttctcgacatgcgactcagccgcgcttttcagtgc
acaaatttcgaccaatccattgacttcatgaatagggtcgcatcaatagcaaacgatatc
aatcaccatcccgatatcgctgtactggacaagcgttcggtgcgcgtgacggcgtggacg
cgcaagctgggctatctgaccgacatcgacttcgatcttgcggcgtccgtcgaggcgatg
tatgcgacagaattcgctgacaggccagcacgatga

DBGET integrated database retrieval system