KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_02407Help
Entry
TBSG_02407        CDS       T01690                                 

Definition
(GenBank) histidinol dehydrogenase hisD
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
mtk00340  Histidine metabolism
mtk01100  Metabolic pathways
mtk01110  Biosynthesis of secondary metabolites
mtk01230  Biosynthesis of amino acids
Module
mtk_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mtk00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    TBSG_02407
Enzymes [BR:mtk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     TBSG_02407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AEB04536
Position
complement(2618486..2619820)
Genome map
AA seq 444 aa AA seqDB search
MTAPPPVLTRIDLRGAELTAAELRAALPRGGADVEAVLPTVRPIVAAVAERGAEAALDFG
ASFDGVRPHAIRVPDAALDAALAGLDCDVCEALQVMVERTRAVHSGQRRTDVTTTLGPGA
TVTERWVPVERVGLYVPGGNAVYPSSVVMNVVPAQAAGVDSLVVASPPQAQWDGMPHPTI
LAAARLLGVDEVWAVGGAQAVALLAYGGTDTDGAALTPVDMITGPGNIYVTAAKRLCRSR
VGIDAEAGPTEIAILADHTADPVHVAADLISQAEHDELAASVLVTPSEDLADATDAELAG
QLQTTVHRERVTAALTGRQSAIVLVDDVDAAVLVVNAYAAEHLEIQTADAPQVASRIRSA
GAIFVGPWSPVSLGDYCAGSNHVLPTAGCARHSSGLSVQTFLRGIHVVEYTEAALKDVSG
HVITLATAEDLPAHGEAVRRRFER
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgccgccgcccgtgcttacccgtatcgacttgcggggagccgagttgacagct
gccgagctgcgggccgctctgccacgcggcggcgccgatgtggaagccgtgctgccgacg
gtacggcccattgtggcggccgtcgccgagcgcggggccgaggccgcgctggacttcggc
gcatcgttcgacggtgtgcggccccatgccatccgggtgccagacgcagcgctggacgcg
gcgctggccggactggactgcgacgtctgcgaagcgttgcaggtgatggtcgagcggacc
cgcgccgtgcactccgggcagcgtcgcaccgacgtcacaaccacactgggcccgggcgcg
acggtcaccgagcggtgggttccggtcgagcgggtaggcctgtacgtgccggggggcaat
gcggtgtacccatccagcgtggtgatgaacgtggtgcccgcccaagccgcgggcgtcgac
tcgttggtggtagccagcccgccgcaggcgcagtgggatggaatgccgcatccgaccatt
ctggccgcggcccggctgctgggcgtcgatgaggtctgggcggtcggcggcgctcaggcg
gtggcgttgctggcttacggcggcaccgacaccgacggcgcagcactgacaccggtcgac
atgatcaccgggcctggcaacatctatgtcacggccgccaagcgactgtgccgttcgcgg
gtgggcatcgacgccgaagcggggccaaccgagatcgctatcctcgccgatcacaccgcc
gacccggtgcatgtggccgccgacctgattagccaggccgaacacgacgagttggctgcc
agcgtgctggtcactccgagtgaggacctggccgatgccaccgacgccgaactggctggc
cagctgcagactacggtgcaccgcgaacgggtgacggccgcgctgaccggacgccaatcg
gcgatcgtcctggtcgacgacgtggacgccgccgtcttggtggtgaacgcttacgccgct
gagcatttggagattcagaccgccgatgccccgcaggttgccagccggatccgctcggcg
ggagccattttcgtcggcccgtggtccccggtgagcctcggcgactactgcgcgggatcc
aaccatgtactgccgaccgcgggctgcgcccggcattccagcggcctgtcggtgcagacg
ttcctgcgcggcatccacgtcgtggaatacacggaggcggccctcaaagacgtttccgga
cacgtgatcacgctcgccacggccgaggacttgccggcgcacggtgaggcggtacggcgg
aggttcgagcgatga

DBGET integrated database retrieval system