KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_02863Help
Entry
TBSG_02863        CDS       T01690                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
mtk00071  Fatty acid degradation
mtk00072  Synthesis and degradation of ketone bodies
mtk00280  Valine, leucine and isoleucine degradation
mtk00310  Lysine degradation
mtk00362  Benzoate degradation
mtk00380  Tryptophan metabolism
mtk00620  Pyruvate metabolism
mtk00630  Glyoxylate and dicarboxylate metabolism
mtk00640  Propanoate metabolism
mtk00650  Butanoate metabolism
mtk00900  Terpenoid backbone biosynthesis
mtk01100  Metabolic pathways
mtk01110  Biosynthesis of secondary metabolites
mtk01120  Microbial metabolism in diverse environments
mtk01130  Biosynthesis of antibiotics
mtk01200  Carbon metabolism
mtk01212  Fatty acid metabolism
mtk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mtk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TBSG_02863
   00630 Glyoxylate and dicarboxylate metabolism
    TBSG_02863
   00640 Propanoate metabolism
    TBSG_02863
   00650 Butanoate metabolism
    TBSG_02863
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TBSG_02863
   00072 Synthesis and degradation of ketone bodies
    TBSG_02863
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TBSG_02863
   00310 Lysine degradation
    TBSG_02863
   00380 Tryptophan metabolism
    TBSG_02863
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TBSG_02863
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TBSG_02863
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TBSG_02863
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtk04147]
    TBSG_02863
Enzymes [BR:mtk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     TBSG_02863
Exosome [BR:mtk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TBSG_02863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AEB04992
Position
complement(3144354..3144596)
Genome map
AA seq 80 aa AA seqDB search
MQLGNQNTMRFAGRPQRFRQSACPLFNPNSAIALGHPFGGSGARLMTTVLHHMPDKGIRY
GLQTMCEGRGQANATIVELL
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttggcaatcaaaacactatgagattcgcagggcggcctcagcgttttcgccaa
agcgcttgccccctgttcaaccccaacagcgcgatcgcgcttggccacccattcggcggc
tcgggggcacggttgatgactacagtgctacaccacatgccggacaagggaattcgctac
ggcttacagacgatgtgcgagggccgcggccaagccaatgccaccattgtggagttgctg
tga

DBGET integrated database retrieval system