KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_03632Help
Entry
TBSG_03632        CDS       T01690                                 

Definition
(GenBank) arylamine N-acetyltransferase nat
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
mtk00983  Drug metabolism - other enzymes
mtk01100  Metabolic pathways
mtk01110  Biosynthesis of secondary metabolites
mtk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mtk00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    TBSG_03632
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TBSG_03632
   00983 Drug metabolism - other enzymes
    TBSG_03632
Enzymes [BR:mtk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     TBSG_03632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-ProteinID: AEB05761
Structure
PDB: 

Position
complement(3989294..3990682)
Genome map
AA seq 462 aa AA seqDB search
MARADAKSPILRACWAILRLLAVAGKQSGEPRPVCRVVGAAVLADGEYADAYVKEQHCRR
SVRRGLPCRPSRHRPASLRCRGSAIASVTGIMMRCCVRRRSSDPPGIRPDGASSHRMGEC
QRAVCRSRRHVSLRGHFVCRRPRNSCGKPQSVRHSWPAARRTPEYPAVGPTRRRGQNGNM
ALDLTAYFDRINYRGATDPTLDVLQDLVTVHSRTIPFENLDPLLGVPVDDLSPQALADKL
VLRRRGGYCFEHNGLMGYVLAELGYRVRRFAARVVWKLAPDAPLPPQTHTLLGVTFPGSG
GCYLVDVGFGGQTPTSPLRLETGAVQPTTHEPYRLEDRVDGFVLQAMVRDTWQTLYEFTT
QTRPQIDLKVASWYASTHPASKFVTGLTAAVITDDARWNLSGRDLAVHRAGGTEKIRLAD
AAAVVDTLSERFGINVADIGERGALETRIDELLARQPGADAP
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcgagcagacgcaaaatcgcccattttgcgggcgtgttgggcgattttgcgtctg
ctcgccgtcgccggtaagcagtctggtgagccacgtccggtatgtcgcgtggttggggca
gctgtcctcgcggatggcgaatatgcagacgcttacgtcaaggagcagcattgtcgccga
tcagttcggcgagggcttccttgtcgtccaagtcgacaccggcctgcaagcctccggtgc
cgtgggtcggcaatagcatcagtaacaggcatcatgatgcgttgttgtgtccggcgccga
tcctccgacccgccgggcattcggccagatggcgcgagcagccaccggatgggtgagtgt
cagcgggcagtttgccgtagccgccgacacgtgtcgctgcgagggcactttgtttgccgt
cgacccagaaactcatgtggcaaaccacaatcggtgcgacatagttggccggctgcgcga
cgaacgcccgaataccctgcggtcggtccgacgcggcgacgaggtcagaatggcaacatg
gcactggatctgaccgcgtacttcgatcgcatcaactatcgcggcgctaccgatccaacc
ctggatgttctgcaggatctggtgaccgtgcacagtcgaacgattccgttcgagaacctc
gacccgctgctgggggtgccggtcgacgacctcagtccacaggcgctggccgacaagctg
gtacttcggcgccgaggcgggtactgctttgagcacaacgggctgatgggttatgtgctg
gccgaactcggctatcgggtgcgccgattcgccgcccgcgtcgtctggaagctcgcgccg
gacgcgcccctgccgccgcagacgcacaccctgctgggggtcacgttccccggctcgggc
ggatgctatctcgtcgacgtcggattcggcggccaaacaccgacctcaccgcttcgcctc
gaaaccggcgccgtccagccgacaacgcacgaaccttatcggctcgaggaccgcgtcgac
ggctttgtcttgcaggcgatggtccgggacacatggcagacactgtacgaattcaccacc
cagacccgcccgcagatcgatctgaaagtggccagctggtacgcctcaacacacccggca
tcgaagttcgtcacgggactgaccgccgcggtgatcaccgacgacgcccggtggaaccta
tctggccgcgaccttgccgttcaccgtgccggtggtaccgagaagatccgccttgccgat
gcggcagcggttgtcgacaccctgagcgaacggttcgggatcaacgtggcagatatcggc
gagcgcggcgcgctcgagacgcgcatcgacgagctattggctcggcagccaggagccgat
gcgccgtaa

DBGET integrated database retrieval system